Commits

Casey Dunn committed 9e021a4

added files

  • Participants

Comments (0)

Files changed (9)

+# Analyses for Siebert at al. manuscript
+
+## Contents
+
+The included files are:
+- `original_sequences.fasta`, the newly sequenced genes for *Nanomia bijuga*. These will be submitted to NCBI.
+
+- `nanos.fasta`, `piwi.fasta`, and `vasa_pl10.fas`, fasta files of protein sequences included in the phylogenetic analyses.
+
+- `nanos.tre`, `piwi.tre`, and `vasa_pl10.tre`, the trees that were produced by the analyses, with bootstrap support values. These trees are graphically presented in the manuscript as Supplementary Figure S2.
+#!/bin/bash
+#SBATCH -J StemCells
+#SBATCH -c 16
+#SBATCH -t 96:00:00
+#SBATCH --mem=62G
+#SBATCH -e stemcells-%j.out
+#SBATCH -o stemcells-%j.out
+
+set -e
+
+## This script aligns and generates Maximum Likelihood gene trees for four
+## gene families expressed in stem cells in Nanomia: Nanos, Piwi, PL10, and Vasa.
+## To align the sequences, it uses MUSCLE http://www.drive5.com/muscle/
+## doi:10.1186/1471-2105-5-113
+## For phylogenetic analysis, it uses RAxML http://www.exelixis-lab.org/
+## doi:10.1093/bioinformatics/btl446
+## For leaf stability analysis, it uses phyutility http://code.google.com/p/phyutility/
+## doi:10.1093/bioinformatics/btm619
+
+## Sequences in each fasta file were recovered from significant 
+## blastp hits against refseq and complemented with sequences from
+## doi:10.1093/molbev/msr046
+
+module load muscle/3.8.31 raxml phyutility/2.2.6
+
+# Alignment
+for FILE in *.fas
+  do
+    BASENAME=${FILE%.*}
+    muscle -in $FILE -fastaout $BASENAME.afas &> /dev/null
+ done 
+
+# Change file format
+for FILE in *.afas
+  do
+    BASENAME=${FILE%.*}
+    awk '{if (NR==1 && $0 ~/>/){print$0;next}if($0~/^>/){print"\n"$0;next}else{printf("%s",$0)}}' $FILE > $BASENAME.mafas
+  done
+
+# This loop is modified from:
+# http://taxevo.wordpress.com/2011/09/23/converting-fasta-to-phylip-using-bash/
+for FILE in *.mafas
+  do
+    BASENAME=${FILE%.*}
+	NUMSEQS=$(grep '>' -c $FILE)
+	NUMBASES=$(grep -m 1 -v '>' $FILE | expr `wc -m` - 1)
+	echo $NUMSEQS $NUMBASES | awk '{ print "\t"$1"\t"$2 }' > $BASENAME.phy
+	cat $FILE | sed 's/>//g' |  xargs -n 2 | awk '{ print $1" "$2" " $3 }' >> $BASENAME.phy
+  done
+
+# Clean up
+rm *.afas *.mafas
+
+# Phylogenetic analysis
+for FILE in *.phy
+  do
+    BASENAME=${FILE%.*}
+    raxmlHPC -s $FILE -n $BASENAME -m PROTGAMMAWAG -p $RANDOM -x $RANDOM -N 500 -f a &> /dev/null
+  done
+
+# Leaf Stabiliy
+for FILE in RAxML_bootstrap.*
+  do
+    BASENAME=`echo $FILE | awk -F . '{print $NF}'`
+    phyutility -ls -in $FILE 1> $BASENAME.leafstab
+  done
+
+
+>XP_002161850.1_Hydra_magnipapillata
+MALSLCKTKDLFSSREGLNLDKFSFNYKQDSQFSVFRDYLGLIRLILPENRIEMSKLHSP
+TESVDNVDFFFNYPNIISSNRHRIDSLDSDETSESSSSEGRGDNEVIYENLSSSEEYSPY
+RQSKVNSIHSNVLAQTYAQTLESLIANQSVVSQQIHNHVQQQIQSKALKNLSKTSVCVFC
+RNNGESREFYSSHTLKDNEGNTMCPILRAYTCPLCKSHGNQSHTIKYCPKYTPKPKTDKL
+LDISMPLL
+>XP_001637175.1_Nematostella_vectensis
+MGDEMLSVFYHGDLYGGSGGKLSMGGMETFKDTLDDQDEFRLFRDYFGLIHLVQNRGVVE
+DEDSVVDQFFNFTYKRTRMDSIGSDRDSVTSSGSSAGSAEFEFKMEPHFGSKAVGSSLLP
+GTRSLTKRTDIDTAARNRKNRENKKNRNANVCVFCRNNGESKKVYSSHVLKDAEGNTTCP
+ILRAYTCPLCKASGSQSHTIKYCPKNKNGSKLQAKV
+>XP_003384296.1_Amphimedon_queenslandica
+MLKALQIGAISKSSSNIAPADSTHNSTAHQEEPVSSHTSRMEPMMDQFSMFTDYFGLFNI
+VSSMRDQHSISDNNNSRERRDSLGSAASSSDFSMSTGGSAPDSSDGSSEFYGGMMNGGIG
+SYPSTPTDFFRAMGESDDALLAFGHHHSIETQHHHSIETQHHHQQQQQQQTNRGGAGVGV
+NGVSSSTLLERGSLSVRVPNRPVKQQVCVFCRNNGESESFYTSHCLKDSEGKVTCPVLRA
+YTCPLCGANGDLSHTIKYCPENNQASKVSTVASQMKRATITITRKK
+>XP_002159764.1_Hydra_magnipapillata
+MTMTDVYMQNFVLKNIFETDDELDLWSSSDSSNSSECSPTFFSRSAKEINDFKLYKDYLG
+LSNLLTNVKISDDNPLVNGVHRLSFLPRNQIYNKLSNDPEGSDVDVYSPTRDLALRSRDN
+NNNFPDVKQLPPSTRLSKSDRDMIISGAFQQQLSFINKHSDRSQIKMNPPLQAPPSPALV
+QPQQTLYNSHDSLTLRASSNVCVFCRNNGESENVYASHVLKDTDGRTSCPILRAYTCPIC
+KANGDNSHTIKYCPMNQNARSASTFNGLSLPPSVNMAPRNTFPQPVRGNFRSPFPVNLTP
+RINLGAKIR
+>XP_003199884.1_Danio_rerio
+MLLLRRTYPRNALDLSALPNLTEYTYIVFVKLSEADMDFLNHNYLSARASYDYTFNFWND
+YLGLSTLVTKNSKHSVPQNPNSITESLKATLGLDDSPPCPCVMGEGDSGGHLDSCCCPPP
+ASISILDLKERFSILSPFQNQNQGSLLSSSQEREIGIGGGFAGFDLFGVERKMRKPAARN
+KQEPKICVFCRNNGAPEEVYGSHVLKTPDGRVVCPILRAYTCPLCSANGDNAHTIKYCPL
+SKDQPAQRVLKGGRAVGGKRVKIF
+>XP_002608940.1_Branchiostoma_floridae
+MYLPGAEDLLEPLPLTSSLNELNRSQLNRSYTKPVPVRSDFSVWGDYLGLVDLVKNVQLA
+QGIQESFLGLDMSVRRPAPSLPLSDPLGSGSTGLSPSLSPTSDEEVDRLFAPISRERFDS
+LGSSGSSSSASSDFYLNGRESDLELGFASLFGDLRLDSPPNSLDGYDFSRQRRREPPSAS
+LSSRDRDILFSVAARRRASRMASGGVGSKSQVCVFCRNNGESETVYASHMLKDCTGKVTC
+PVLMAYTCPLCHATGEEAHTIKYCPQNTNQLPNVKSLKTARTSTGKKRPV
+>NP_001161595.1_Saccoglossus_kowalevskii
+MMRSQFQPLKDYLGLANLVGNIRELQNSQHLSSPEDFDVDKFFFPPVPRGRFDSMGSSSS
+SSASDFSLNGTDRDIDCCSSYNFSDFPVARNLSPLDFLMNGTDFDYTPPYGFSDFEVNRL
+HSPLDLCSGRNSLAINRRGKQSRKKAQQVCVFCRNNGESESVYADHALKDSEGKVTCPVL
+RRYTCPICGANGDEAHTIKYCPHGNKNDEQPSMKMLKATRTSTGKKRSI
+>XP_003970707.1_Takifugu_rubripes
+MDFLNHNYLNARSPYDYTFNFWNDYLGLTTLVTKNNKLNMPQNPNSITESLKATLGLDDS
+PTCPCVIAGSVGESGHMDCCCPSGSPPPASILDLKERFSILSPFQNQLDVQPEREVSFGG
+SFAGFDLFGMERKIRKPASRSKQEPKICVFCRNNGAPEEVYGSHVLKTPDGRVVCPILRA
+YTCPLCSANGDNAHTIKYCPLSKDQPSQRPLKGGRAVGGKRMKIF
+>XP_003443401.1_Oreochromis_niloticus
+MDFLNHNYLNARNPYDYTFNFWNDYLGLTTLVTKNNKLSMPQNPNSITESLKATLGLDDS
+PACPCIIAGAVGESGHLDCCCPSGSPPPASILDLKERFSILSPFQNQLGVQLPEREVGFG
+GNFTGFDLFGMEKKMRKPASRSKQEPKICVFCRNNGAPEEVYGSHVLKTPDGRVVCPILR
+AYTCPLCSANGDNAHTIKYCPLSKDQPSQRPLKGGRAVGGKRMKIF
+>NP_001073023.1_Strongylocentrotus_purpuratus
+MYDPFNDYFGLSGLLSNCRVNDDFISTPFHHNDDFNSNGVNVPVMSRSSSSISDMNNNMV
+SGLPVSTSQSSTTASTGFMPLQLPLNIAEITELSKVMRGGRRANNGRGGATGVGGRPPSW
+CVFCKNNGESEMVYASHKLKSEEGITTCPILRAYTCPLCGTNGDRAHTIKYCPLNKYKDE
+VVGSSSGPGTIGSQYRTPRTSTGRRRTSSLSLSSGGSSSSYIGGNMVPGNIA
+>XP_003962918.1_Takifugu_rubripes
+MDFLDLEARSPYEYTFNFWNDYLGLSTLVAKSKIHSPSCSPNSITRSLKATLGLEDESPV
+CSCVIGHARDSDGHLECCCAAPGSPPISFYDLNERISLLRPYEHFAGGGRDSPSHGGSLA
+GLDLLSMDRRRKQSQRGKPEPKVCVFCRNNGAPEEVYGTHILKTADGRVLCPILRAYTCP
+LCSANGDNAHTIKYCPLSRDQASQRMAKGGRVMGKRLKIF
+>XP_003490239.1_Bombus_impatiens
+MHILCPQTLPLPEVSNMFYPFNTSLEEEIKRLFSNFTIETPNSSLPDVDEVMEDFRQNGR
+DFEYCPDLDNFTVPEIPRRKKNKKPLPTECVFCRNNGEEEAYYRKHLLKDAEGRVSCPVL
+RAYTCPICGAYGDVAHTVKYCPKSQKPGTLATVNTFKLLRNSMGKRRVK
+>NP_001035321.1_Apis_mellifera
+MEEFRHNGRDFEYCPDLDNVTMPETTPRRKKNKKPLPTECVFCRNNGEEEAYYRKHLLKD
+ADGRVSCPVLRAYTCPICGACGDIAHTVKYCPKGTKNPGTLATVNAFKLLRNSMGKRRVK
+>XP_003447814.1_Oreochromis_niloticus
+MDFLDRGYLDARSPYDYTFNFWNDYLGLSTLVAKNKINSPPFSPNSITESLKATLGLEDD
+SPVCSCVIGHGRDTNDGPLDCYCAAPSSPPISIYDLKERISLLRPYEHLASDSQLGDRDS
+PSYKGSFSGFDLLAMDRRRKQAQRGKPEPKVCVFCRNNGAPEEVYGTHILKTADGRVLCP
+ILRAYTCPLCSANGDNAHTIKYCPLSKDQPSQRVAKGGRAIGKRLKIF
+>NP_001098702.1_Bombyx_mori
+MDSMSYNFNMEDEKPIFTTASDVTTTTTTESYTTTGLDNITINSQEGSFSATTPSFQRGG
+NDLLNLLARQEPRAADPAPNSTEMEDILLNMRLNGTDPLFDDMDPNHNYFLGGRPESVAS
+SNLWNDNSSVSGARNGEMMDTFDFLIKSLSSANNYVSMLTREQLSVLRSIRPSLLYEFLQ
+EVAKVRSDRRMRRALPNECAFCKNNGENEECYSSHALKDWRGRVLCPVLRAFRCPRCGAT
+GDRAHTIKYCPENSDASSDRSGSLSARRRVPPSASLVMGGTNRTGFGPLTPSAPASSPVP
+TSTSFPNSSFWTSFSMN
+>XP_541547.1_Canis_lupus
+MQLPAFDMWKDYFNLSKVVLALIQSGGQRPEAQGNGEPRPGPQLGQDQGVGGPGASRSLA
+TLCNFCKHNGESRHVYSSHQLKTPEGVVVCPILRHYVCPLCGATGGQAHTLKYCPLNGGQ
+QSLYRRSGRNSAGRKVKR
+>XP_002928544.1_Ailuropoda_melanoleuca
+MQLPPFDMWKDYFNLSQVVLALIQSGGQRPEAQGDGELKPGPLLGQEQGLGGLGASRGLA
+TLCNFCKHNGESRHVYSSHQLKTPEGVVVCPILRHYVCPLCGATGGQAHTLKYCPLNGGQ
+QLSTXXSLYRRSGRNSAGRKVKR
+>XP_001502873.1_Equus_caballus
+MQLPPFDMWKDYFNLSQVVLALIQSRGQRPEAQGTGESRPEPPLGQDQGLGGPGAGRGLA
+TLCNFCKHNGESRHVYSSHQLKTPEGVVVCPILRHYVCPLCGATGGQAHTLKYCPLNGGQ
+QSLYRRTGRNSAGRKVKR
+>NP_918953.2_Mus_musculus
+MDLPPFDMWRDYFNLSQVVMDIIQSRKQRQEGEVAEEPNSRPQEKSEQDLEGYPGCLPTI
+CNFCKHNGESRHVYTSHQLKTPEGVVVCPILRHYVCPLCGATGDQAHTLKYCPLNSSQQS
+LYRRSGRNSAGRRVKR
+>XP_003433634.1_Canis_lupus
+MEAFPWAPRSPSRGRAPPPMALVPSARYVSAQGPAHPQPFSSXNDYLGLDTLINEXAPAA
+AAAAAFASAEVAPREERAPAWAAEPRLHVASGAAAARLLKPELQVCVFCRNNKEAVALYT
+THILKGPDGRVLCPVLRRYTCPLCGASGDNAHTIKYCPLSKPPPPPPPPRPARDCPPGKK
+LR
+>NP_001128394.1_Nasonia_vitripennis
+MARVLSMPIPMPQYYGQKSQPNMLFPLNPSLEDELNRLFVDFRVSHAPVAFATDDVWEEF
+KHNGRDYEYCPDPDEVIVPAQPSKKKNKKPLPNECVFCKNNGEDIKIYKKHLLKDADGKI
+LCPILRNYTCPICGANGDAAHTIKYCPANKQTHSLASMNTLKTLRNSTGRRRSK
+>XP_002915453.1_Ailuropoda_melanoleuca
+MATSSCRLMASRPELQVCVFCRNNKEAVALYTTHILKGPDGRVLCPVLRRYTCPLCGARG
+DNAHTIKYCPLSKVPPPPNARPTPRSARDCQPGKKLR
+>NP_848508.2_Mus_musculus
+MEAFPWAPRSPRRARAPAPMALVPSARYVSASGPVHPQPFSSWNDYLGLATLITRASDRG
+SPHEGPGPTAAGPTMGPPEDDEDDDGEEPEAGGRYLGGALELRALELCAGPAEPGLLEER
+FAELNPFAGRAAAVLLGCAPTASTTAAAASTAEVTPREEPSPAWAAEPRLHAASGATAAR
+LLKPELQVCVFCRNNKEAVALYTTHILKGPDGRVLCPVLRRYTCPLCGASGDNAHTIKYC
+PLSKVPPPTVRPPPRSNRDSLPSKKLR
+>XP_003703618.1_Megachile_rotundata
+MHVPLVQKLPMPQVSNFFYPFNTSLEEEMKRLFQFTIETPPPPVPNVEAVMEEFRRNGRD
+FEYCPDLDNGAPEITPRRKKNKKPAATECVFCKNNGEEEAYYRQHSLKYDDGRVSCPVLR
+AYECPICHACGDDAHTIKYCPKRPKSPGTMPTVNAFKLLKNSMGKRRVK
+>XP_003641548.1_Gallus_gallus
+MRERRAPPPFPPPPLFKGRRAAARSRRKRGRRWERSRGGAAVRRAVGGAGGRSRTAPPME
+AFPGGKLEPHRHLPPVERLPGARYGGRSHAACGNVFNSWNDYLGLATLITKAVRPGKGFG
+AEPPAVVVAAAEEEEEEEEEEEEEAAGPYFEGALDLHELELCGHHHHHGDGLLEERFADF
+SPFPGRGGPAAVLFDCSGEHAGRDGSAHAWGAGVVVAGRLPAHPRAAGRLLKPELQVCVF
+CRNNKEAVALYTTHILKGPDGRVLCPVLRRYTCPLCGASGDNAHTIKYCPLSKMQAAKQL
+RHARTALGKKAR
+>XP_003904371.1_Papio_anubis
+MEAFPWAPRSPRRGRAPPPMALVPSARYVSAPGPAHPQPFSSWNDYLGLATLITKAVDGE
+PRFGCARGGNGGSGSPPSSSSCCSPHAGTGPGALGPALGPPDYYEDDDDDDSDEPGSRGR
+YLGGALELRALELCAGPAEAGLLEERFAELSPFAGRAAAVLLGCAPAAAATTSEATPREE
+RAPAWAAEPRLHAASGAAAARLLKPELQVCVFCRNNKEAMALYTTHILKGPDGRVLCPVL
+RRYTCPLCGASGDNAHTIKYCPLSKVPPPPARPPPRSTRDGPPGKKLR
+>NP_955631.1_Homo_sapiens
+MEAFPWAPRSPRRGRAPPPMALVPSARYVSAPGPAHPQPFSSWNDYLGLATLITKAVDGE
+PRFGCARGGNGGGGSPPSSSSSSCCSPHTGAGPGALGPALGPPDYDEDDDDDSDEPGSRG
+RYLGSALELRALELCAGPAEAGLLEERFAELSPFAGRAAAVLLGCAPAAAAAATTTSEAT
+PREERAPAWAAEPRLHAASGAAAARLLKPELQVCVFCRNNKEAMALYTTHILKGPDGRVL
+CPVLRRYTCPLCGASGDNAHTIKYCPLSKVPPPPARPPPRSARDGPPGKKLR
+>NP_001025032.1_Homo_sapiens
+MQLPPFDMWKDYFNLSQVVWALIASRGQRLETQEIEEPSPGPPLGQDQGLGAPGANGGLG
+TLCNFCKHNGESRHVYSSHQLKTPDGVVVCPILRHYVCPVCGATGDQAHTLKYCPLNGGQ
+QSLYRRSGRNSAGRRVKR
+>XP_001376960.1_Monodelphis_domestica
+MEAFQAVASKLPPPHHHHPHQRQHPPPMAFLQSARYVTAKSHHPHGSGSAFNSWNDYLGL
+ATLITKAVGEEKGFGGDPASPSSSSSSSCCSPHAGAAGGMVVAAAALGPPDDEEDDDEEA
+ATTPYFGSALDLRDLELCGAHPADGLLEERFADFSPFSGGAGPTAAAAAAVLFDCASEPL
+ERDRAPAWGGAAEPRLQSGPKPAGRLLKPDLQVCVFCRNNKEAVALYTTHILKGPDGRVL
+CPVLRRYTCPLCGASGDNAHTIKYCPLSKMQAHATKQIKNARNVLGKKIR
+>XP_002829477.1_Pongo_abelii
+MQLPPFDMWKDYFNLSQVVWALIASRGQRLETQEIEEPSPGPPLGQDQGLGGPGANGGLG
+TLCNFCKHNGESRHVYSSHQLKTPDGVVVCPILRHYVCPVCGATGDQAHTLKYCPLNGGQ
+QSLYRRSGRNSAGRRVKR
+>XP_003915791.1_Papio_anubis
+MQLPPFDMWKDYFNLSQVVWALIANRGQRLETQETEEPSPGTPFGQDQGLGGSGANGGLG
+TLCNFCKHNGESRHVYSSHQLKTPDGVVVCPILRHYVCPVCGATGDQAHTLKYCPLNGGQ
+QSLYRRSGRNSAGRRVKR
+>XP_001111556.1_Macaca_mulatta
+MQLPPFDMWKDYFNLSQVVWALIANRGQRLETQETEEPSPGPPLGQDQGLGGSGANGGLG
+TLCNFCKHNGESRHVYSSHQLKTPDGVVVCPILRHYVCPVCGATGDQAHTLKYCPLNGGQ
+QSLYRRSGRNSAGRRVKR
+>XP_004061051.1_Gorilla_gorilla
+MQLPPFDMWKDYFNLSQVVWELIASRGQRLETQEIEEPSTGPPLGQDQGLGGPGANGGLG
+TLCNFCKHNGESRHVYSSHQLKTPDGVVVCPILRHYVCPVCGATGDQAHTLKYCPLNGGQ
+QSLYRRSGRNSAGRRVKR
+>XP_003940311.1_Saimiri_boliviensis
+MQLPPFDMWKDYFNLSQLVWALIESRGQKLETQEIEEPSPGPPLGQDQGLGGPGAPGSLG
+TLCNFCKHNGESRNVYSSHQLKTPDGVVVCPILRHYVCPVCGATGGQAHTLKYCPLNGGQ
+QSLYRRSGRNSAGRRVKR
+>XP_002576848.1_Schistosoma_mansoni
+MSPKTNDIEIVQTNARDLISYGNNNINGSRRQTEEYLDYIRCMIGWRNIIYTCLTSNQTL
+DESHLLDLAKFLQNMAISTQRLLEANVDLCVFCRNNNEPKEIYTSHKVKDRFGRVTCPIL
+RKFTCPLCGATKDRAHTIRYCPKLLITNHNRNGNSSGGPTCPMIEAGLLEPIQFSTPN
+>XP_002756490.1_Callithrix_jacchus
+MEIGTTKSEVKACSGVQCCNHEEGGGQIGRDVKSTPPSPDPTNQHPERRPRRRVYGRQPM
+SAAARGGASPALSRNDGCPAAGEAGAAHGAREPRGPGAGARSQFRSPPLPSSVQGRGLRC
+QAHPQPISSWNDYLGLATLITKAVDGEPRFGYARGGNGGGGSPPSSSHSSCCSPHGGAGP
+GALEPALGPPDYDEDDDDDSDEPGSRGRYLGGALELRALELCTGPAEAGLLEERFAELSP
+FAGRAAAVLLGCAPAAATATATTTTTGEATPREERAPAWAAEPRLHAASGAAASRLLKPE
+LQVCVFCRNNKEAMALYTTHILKGPDGRVLCPVLRRYTCPLCGASGDNAHTIKYCPLSKV
+PPPPPARPPPRSARDCPPGKKLR
+>XP_001363834.1_Monodelphis_domestica
+MQLPAPFDMWKDYLNLNKILWEVISGQGGPGGGERGQQEAEAGQERQVVAGGPLCNFCKH
+NGESRHVYTSHLLKTPEGIVVCPILRHYVCPLCGATGGLAHTLKYCPLNGGQQSLYRRSG
+RNSAGRKVKR
+>NP_001098700.1_Bombyx_mori
+MDVQIPFIAHHSVGQTFEEILPSTSAYIKKQPEFLESGCILKKDALQAVKLDPAVLEAQI
+TVETRKIDGTDSTQTQVSSQGSELPAEALRVDFKKIVSMHETALLSLTPDQYQFLLIYVE
+ALRQKRIGLQKHFECAFCKKNGESVSWYRTHALKDGRGRVKCPVLRGFRCPRCGATGDRA
+HTIKYCPQNSD
+>XP_002114667.1_Trichoplax_adhaerens
+CVFCRNNGEHEDVYTSHQLKDADGKITCPILKAYTCPICGATGENSHTIKYCP
+>XP_003748633.1_Metaseiulus_occidentalis
+MKSSKIPRPLGKPDDQRDIFTNAGLWQPEPRAILRRFEPGECTPLDVGSPTAPPPPRMAS
+MERTIDVTLDCSIENGRRYDTFCVFCRNNRLPEEFYRSHPLKDNRGNVVCPILRNYNCPS
+CNNGGGDRAHTVNYCPKKRAQYFDSFMKGQKL
+>XP_002762341.1_Callithrix_jacchus
+MQLPQLPPFDMWKDYFNLSQLVWELIESRGQKLETQETDEPSPGPPLGQDQGLGGPGAPG
+GLGTLCNFCKHNGESHNVYSSHQLKTPDGMVVCPILRHYVCPVCGATGGQAHTLKYCPLN
+GGQQSLYRRSGRNSAGRRVKR
+>NP_988857.1_Xenopus_tropicalis
+MDGGLCFNSWSDYLGLSSLISRGLQPREGGESPRPRWKASSPTPAEPLPSKAAEAHGHKG
+CGFCRSNREAQSLYSSHRLRAPDGRVLCPVLRGYTCPLCGANGDWAHTMRYCPLRHFLRH
+PHSPRDGQ
+>NP_001093314.1_Bombyx_mori
+MIGKCSLDDAMKEFRLNGLDSPYNPDEDNIWSARAVADTSTQWNTYSRQVSWPAPERSPK
+VPLPGSHWTSGLSSPPVRNETLTPPAASQVQPTEEQLRVLSSLPDAVLYTLLRKLERIRG
+DDATRTNEECRFCKNNGERAAYYRSHALRDAAGRVACPVLRAFVCARCGARGDAAHTAKY
+CPRATRDERIKSAAMMRSVRSASSRRRQAALLPAGPEYVTFGERPPSAARDTRLYGAFDS
+APLDPLWAALEQKLML
+>XP_001377519.2_Monodelphis_domestica
+MEVFNLWRDYLGLANVVGALREEKLEPEAQGARTEASPGSGTGPSLPPREPLCTFCKHNG
+ESRNIYLSHSLKDDEGRVVCPILRKYVCPQCRATQDNAHTKRFCPLTSKGYMSVYSYTAR
+NSAGKRTTLQWPPEELGPAKGRPKKMPATAAALPDGKTPSRPQDESHARAGSSGSGFPFS
+SLVLPPLRLHLGHLCMTNSSGCL
+>XP_004060189.1_Gorilla_gorilla
+MGTFDLWTDYLGLAHLVRALSGKEGPETRLSPQPEPEPMLEPVSAPEPVSALEPMPAPES
+VPVPGPKDQKRSLESSPAPERLCSFCKHNGESRAIYQSHVLKDEAGRVLCPILRDYVCPQ
+CGATRERAHTRRFCPLTGQGYTSVYSHTTRNSAGKKLVRPDKAKTQDTGHRRGGGGGAGF
+RGAGKSEPSPSCSPSMST
+>XP_002828811.1_Pongo_abelii
+MGTFDLWTDYLGLAHLVRALSGKEGPETRLSPQPEPEPVLEPVSAPEPVSALEPMPAAES
+VPVPGPKDQKHSLESSPAPERLCSFCKHNGESRAIYQSHVLKDEAGRVLCPILRDYVCPQ
+CGATRERAHTRRFCPLTGQGYTSVYSHTTRNSAGKKLVRPDKAKTQDTGHRRGGGGGGGG
+GAGFRGAGKSESSPSCSPSMST
+>XP_003455853.1_Oreochromis_niloticus
+MESDGKSFQPWRDYMGLCDTIRDILGRSTVSESSQPVSKAHHTECDMSRAMVSLRINAAR
+QSGLGAESAPDPCSRECALTSSPARMDPVDGVAYAPNAIDLKLMQNPPGSRGPKDRKKTS
+RFKTPEAVLPTPDRMFCSFCKHNGESELVYGSHWLKNQEGDVLCPFLRQYVCPLCGATGA
+KAHTKRFCPKVDSAYSSVYAKSRR
+>XP_003275656.1_Nomascus_leucogenys
+MGTFDLWTDYLGLAHLVRALSGKECPETRLSPQPEPEPVLELVSAPEPVSALEPMPAPES
+VPVPGPKDQKRSLESSPAPERLCSFCKHNGESRAIYQSHVLKDEAGRVLCPILRDYVCPQ
+CGATRERAHTRRFCPLTGQGYTSVYSHTTRNSAGKKLVRPDKAKTQDTGHRRGGGGGGAG
+FRGAGKSEPSPSCSPSMST
+>XP_003242523.1_Acyrthosiphon_pisum
+MSGRSRFAFGSQTQAPQYQNRCALCLTTTTEDGNATAVCQHTASVESALHYLRNYGAPTS
+PPYGPSPYHAQQDAAPAPATSALPSFGGCSPPVSPNYYTLAEFLLRMNRMQQENTGGYHH
+LRQPPISSRPPKPKSEMGCLRECAFCKSNGETAEFYKSHFLKDPVGRVRCPILQRYQCPF
+CYATGENAHTRRYCPKNPNKMCFIKGDQLVKQNLQ
+>XP_316157.2_Anopheles_gambiae
+MEVTKQNASDNKTTEALWKLILAPYGWNEQMNEAAREFLKNYPDFIPMLIGQSPYKIDLR
+SLIMEARANKWHNTTLDEIREDFEANGTTCELEEEVYLQPKHAPEMDGSELMEAVDVAAE
+LKNMVLQDISNQPKQQSTTRPLRKCRNKSTCELDHCVFCFNNKADREVYESHRCKDEAGN
+VTCPVLQTFVCMRCKATGTKAHTAKYCPLKPVITPEDCLAMELRRHKIHRKGVCTASEIN
+LSVGSSSAIVHSKKRLVRL
+>NP_001092092.1_Homo_sapiens
+MGTFDLWTDYLGLAHLVRALSGKEGPETRLSPQPEPEPMLEPVSALEPMPAPESVPVPGP
+KDQKRSLESSPAPERLCSFCKHNGESRAIYQSHVLKDEAGRVLCPILRDYVCPQCGATRE
+RAHTRRFCPLTGQGYTSVYSHTTRNSAGKKLVRPDKAKTQDTGHRRGGGGGAGFRGAGKS
+EPSPSCSPSMST
+>XP_003439364.1_Oreochromis_niloticus
+MTTMPRRLEVQSSILPGGDCFNMWQDYMNLSQVFERLCSNREVENRDTERPKKGQAPPWS
+KVHTSTRGKKSSKNSSQSSPTSSASDTSSSASSSDYCRFCKQNGETPRVYRSHKLKSDDG
+KVFCPILRNYTCPICEATGDSAHTRRYCPQMKWEAAGRMETGAKFCKEPSSITSGATSRS
+ALARQYAQAQREKTAPALGVSQVLVAAEN
+>NP_571953.1_Danio_rerio
+MAFSLLQFILSAHGSMETRNQDFQPWKDYMGLADMIRGMKRQEMQSDADSDEQAAALLES
+PSGPIRSRDSPEQNTSPGGGKPKSSPAERKFCSFCKHNGETEAVYTSHYLKNRDGDVMCP
+YLRQYKCPLCGATGAKAHTKRFCPMVDKNYCSVYAKSTW
+>XP_001171060.1_Pan_troglodytes
+MGTFDLWTDYLGLAHLVRALSGKEGPETRLSPQPEPEPMLEPVSAPEPVSALEPMPVPES
+VPVPGPKDQKRSLESSPAPERLCSFCKHNGESRAIYQSHVLKDEAGRVLCPILRDYVCPQ
+CGATRERAHTRRFCPLTGQGYTSVYSHTTRNSAGKKLVRPDKAKTQDTGHRRGGGGGAGF
+RGAGKSEPSPSCSPSMST
+>XP_003915072.1_Papio_anubis
+MGTFDLWTDYLGLARLVRAFSGKEGPETRLSPQPEPEPVLEPVSAPESVSVPESVSVPDV
+SVPESVPVPGSKDQKRSLESSPAPERLCSFCKHNGESRAIYQSHVLKDEAGRVLCPILRD
+YVCPQCGATRERAHTRRFCPLTGQGYTSVYSHTTRNSAGKKLVRPDKAKTQDTGHRRGGG
+GGGGGGGAGFRGAGKSEPSPSCSPSMPT
+>XP_001655854.1_Aedes_aegypti
+MENVNSYYFLAPAIKSFNSSGDSFESDPSLIYSSSSDSDVNDLTATFQELVIDVNGMVRE
+LFEKNTDLHRDTDSIRQDFIRNGIDSSMTECLSSRRLPPPGIGVISKWPLSMCDNESSSA
+TNPNGIKTDDSERKRNKGAFQSFRRKRSKENEDYCVFCYNNREEQETYLGHSCRDGEGFV
+VCPKLQRYVCPYCQATGHLAHTKKYCPKKPIITPDDLRGMTVPFDGPANTSGRNRSVGRG
+KKSLRF
+>XP_001111100.2_Macaca_mulatta
+MGTFDLWTDYLGLARLVRAFSGKEGPETRLSPQPEPEPVLEPVSALESVSVPESVSVPES
+VPVPGSKDQKRSLESSPAPERLCSFCKHNGESRAIYQSHVLKDEAGRVLCPILRDYVCPQ
+CGATRERAHTRRFCPLTGQGYTSVYSHTTRNSAGKKLVRPDKAKTQDTGHRRGGGGGGAG
+FRGAGKTEPSPSCSPSMPT
+>XP_002921037.1_Ailuropoda_melanoleuca
+MGTFDLWTDYLGLARLVGALRGEEEPETRPDPQPQPAPGPEARRPSPESSPAPERLCSFC
+KHNGESRAIYQSHVLKDEAGRVLCPILRDYVCPQCGATRDRAHTRRFCPLTGQGYTSVYS
+YTTRNSAGKKVSRPDKARMQDPGNRRAGTGAAAAAAACAGAWGGPLWRGRHWACG
+>XP_003432960.1_Canis_lupus
+MGTFDLWTDYLGLARLVGALRGEEESKTRLDPQPQPAPGPGGQRPSPESSPAPERLCSFC
+KHNGESRAIYQSHVLKDEAGRVLCPILRDYVCPQCGATRERAHTRRFCPLTGQGYTSVYS
+YTTRNSAGKRVSRPDKARMQDSGHRRGGAGAAGSKGAGKSSGPSPSSFCPSTSA
+>NP_476658.1_Drosophila_melanogaster
+MFRSNLEGSGAAAVGVANPPSLAQSGKIFQLQDNFSAFHARGGLNILGLQDMYLDTSGAN
+SSATLSPPITPVTPDPSTSAQSTHFPFLADSAATANSLLMQRQYHYHLLLQQQQQLAMAQ
+HQLALAASAAAASASHQQTDEIARSLKIFAQVTTGAAENAAGSMQDVMQEFATNGYASDD
+LGRMSYGSAPPQVQMPPQQQHQQQQGLHLPLGRNPAQLQTNGGNLMPIPLATHWLNNYRE
+HLNNVWRNMSYIPAAPNTMGLQAQTAATVSTNLGVGMGLGLPVQGEQLRGASNSSNNNNN
+NNKVYKRYNSKAKEISRHCVFCENNNEPEAVINSHSVRDNFNRVLCPKLRTYVCPICGAS
+GDSAHTIKYCPKKPIITMEDAIKAESFRLAKSSYYKQQMKV
+>XP_003745542.1_Metaseiulus_occidentalis
+MECAEIVSMQMTEMPVAPPCTPSPQPGDRTYAKEDEEMQMAGGMCDGVTVLGMTPGTKGA
+APQQAPAYPQYYAPQYYQYTAVPQGGTPYGPTLMYTMPMPYYPNVRQGAQPYQMDYGSVQ
+QQQQQPPHGKPHVEPPTIVKTPSRQRVVIWNYCQFCQNNREPEEFYRGHILRDAEGKVVC
+PILRAYNCPICNNGGGERAHTKSYCPQLRASRLPRRSSLF
+>XP_002576493.1_Schistosoma_mansoni
+MLDFRRTPCYDLWSTQKSEVSDENVSYVGCAGYIPSLCDPLLDALNKLSISPESPDRLSG
+IGYHTGDNITPVVRNPDSHTRYPKESKSTHLDFDAVRLNPFGVSPNYMETFENLCGCGHN
+TQSEIRLPRSDNIFSHSPVTCGDVNKAQFTNQTNQLVSIRKNNCPLPCDEYPANIVIDGG
+AWNGLPLRDAIGAALVILTSKSKASGCRRMISRSSHRNKKWDRETLKLHSWFNSFCLLEM
+PASLKQIFLSVRRKLEEDYVLCAFCRNNGELPEIYITHEVRDQDGRVTCPVLRVLSCPNC
+HATGDHAHTIRYCPYPRQL
+>XP_003743066.1_Metaseiulus_occidentalis
+MDRFSSADLSNPSCAAKILKSQLESLRHLARKRRNKSGREFGVARTSSEKRSSRSLDDTK
+RADPFCVFCKKNGAPKDAYRSHTVKDNRGNVVCPILRKFNCVHCNNGGGDQAHTANFCPK
+MRGAYLNSFMKNKDEA
+>NP_918948.1_Mus_musculus
+MGTFNLWTDYLGLARLVGALHKEEELDVRLDPKPEPKPSSESQQASKESSAAPERLCSFC
+KHNGESRAIYQSHVLKDEAGRVLCPILRDYVCPQCGATQEHAHTRRFCPLTSQGYTSVYC
+YTTRNSAGKKLTRPDKAKTQDAGHRLGGEAAAGVYAGSKSGRKPPGPSPSACCPSTTA
+>XP_001861874.1_Culex_quinquefasciatus
+MFPTRFPTAGDPAVDVSDPLFGMYSWYSGESSSSSDDLSELAASFRSALALDLEAFGRDA
+LGMQHARPNLSLVRDDFIRNGIDSAIPGRSVRRRPPGFVQEPVSSPRWPLTSLENVLQTS
+TPVEQQPPPPKTGSSDGRSRRKHKENDYCVFCYNNGEHQEVYMSHVCRDERGQVQCPRLR
+RYICPYCFATDRNAHTKKYCPNKPIITPEDLLKMPAGETADAAPVPVAKSKSKKSLRSCV
+PFGASQELEVFVKKPL
+>XP_003972111.1_Takifugu_rubripes
+MDVGLVSPPCDQSKRLQLRSNQQEAALRRQELQLNRLKDRLTDRPRDKGPWGFRHSSRFM
+EPNYKPFHMWKDYFGLSDVIKEIIRSRQYASSLPVSRRSQEPCRSLESLFSNCERGIVDD
+MSLSLLLGSSNRCGVEETSASASRFQHADIKGTAKVTRRWRTPETQALETRLCQFCKNNE
+ESVLVYRSHWLKGPTGEVLCPFLRKYVCPLCGATGPKAHTLRFCPKVDSTYSSVYVTSKL
+NPKV
+>XP_003941756.1_Saimiri_boliviensis
+MGTFDLWTDYLGLARLVRALSGKEEPETRLNPQPEPEGPVPEPVPTPRAQEEQHWLEPAP
+APERLCSFCKHNGESRAIYLSHVLKDEAGRVLCPILRDYVCPQCGATREHAHTRRFCPLT
+GQGYTSVYSHTTRNSAGKKLVRPDKAKTQDSGHRRGGGGGGGGGGGAAGFRGAGKSEPSP
+PSGSPSMST
+>XP_001641215.1_Nematostella_vectensis
+MSLSEVMLKTLIPSNFLDSDDEEIKSLTCTTESDDLQKNQYTNYNMFNDYFGLSNLVQKV
+RLANNDFPYLGSDGYGGKLHRRDRFDSIDSENSSSGSCDSFTDHGLTFGEGSFQPFSTSS
+ILHSAGKRKEVALPPSRRLGKPTARSSAPGANRQVCVFCRNNGESEEVYASHVLKSADGK
+TTCPILRAYTCPIFSKRKEMASFLLHQSNHQPAQHSQSLAPRGE
+>XP_001494869.1_Equus_caballus
+MGTFDLWTDYLGLARLVGALRGKEEPETRVDPQPEPVPGPGGQRPTPESSAAPERLCSFC
+KHNGESRAIYQSHVLKDEAGRVLCPILRDYVCPQCGATREHAHTRRFCPLTGQGYTSVYS
+YTTRNSAGKRLARPEKARAQDSGPRRGAGAGAGAGGACAGAGVRGVRMLPPCCRGLRLGG
+GWNPRRMHSPPPRACLKGGGLGAAALQLDRWPDVSVGSVGCCSRYR
+>XP_003243868.1_Acyrthosiphon_pisum
+MILHDGIMFDDGSSYQQKMFDRAAVLLQKFPFRFLNRVSRENTERSGNSRKMAFYYSKRF
+PNMCMSSSFYDDVMNIAEMHVNYYKSRWFDFGELYSEPSFNESTVPWTNRPVLRPVHTQN
+TFVHSVNYNYNNNQRDLANSHTLKVQLPNKLVTILVPTPSSVESLSASSSPLDFEEPITP
+IKVISKNNNDFKKSPEENNNKIHVIENDDTKSGSIDSDSSRSETPIDEKTVSYAEIIKYS
+KPTKPKQSEKPDYNIIEESRKESIKSNRIPPSKKISIKLPDAPFLPNNQHCAFCKNNGEE
+ESVYRTHFVKDELGNVKCPFLSRYTCPHCKATGTKAHTISRCPLSNKNRINKFNKQQ
+>XP_002761839.1_Callithrix_jacchus
+MGTFDLWTDYLGLARLVRALSGKEGPETRLNPQPEPEEPVPEPVPTPGPQEEKHCLEPSP
+APERLCSFCKHNGESRAIYLSHVLKDEAGRVLCPILRDYVCPQCGATREHAHTRRFCPLT
+GQGYTSVYSHTTRNSAGKKLVRPDKAKTQDSGHRRGGGAGDCTGFRGAGKSEPSPSSGSP
+SMST
+>XP_003740500.1_Metaseiulus_occidentalis
+MQMLQSGLQDIALSSLSLSWPRDHCEDPFASDPWSEDRRNLSPAISFNQGYSFSFAPSGH
+SSNASQGELPSWSPQRSDDPLHKFRASMQTGELSKLTEQSSSFLSNTTNRKKSVNSQHSP
+STTWSAVVQKNPRPMKHKKPKPAKTFTVTLSACCMTPKIRLICTCCNEETFIKVKEEMKP
+RLIPVSTSQLGFCRFCQTNGDPPEVYQSHSLRSDDGKVTCPVLREYNCPICNNGGGDFAH
+TIKYCPMARKAKPSN
+>XP_002434012.1_Ixodes_scapularis
+MKWEEGPAIPRESRHEPRFSSFDGCAYCRSSGQQRDFYMSHSIREGLDGPVTCPVLRNYT
+CPVCGNRGGDNAHTIRYCPMNHGQVVSAASVYRTPRMSNGRQRLPVANTRPERKDVGAAG
+RGRGFRR
+>XP_003743067.1_Metaseiulus_occidentalis
+MDRFNFANASDSTRAAEILKSQLGTLQSLTRKSPGKAREDSAVDGPPLEQRVPRSIDDSG
+RADPFCVFCKKNGAPKAVYRSHTVKDNRGSVVCPVLRKFNCHHCNNGGGDQAHTANFCPK
+KREVYLNSFLKNKDEP
+>XP_003968060.1_Takifugu_rubripes
+MQSQIGVQTFDMWHDYMNLGSLLKRLHDRRPEDHDAPKRSAAASEGREVYRISTDASSVS
+SLSDASSSGTSSDADFCRFCKQNGESPRVYRSHTLKSADSRVVCPILQNYICPICGATGD
+YAHTRRYCPVVRRQGDRKLAGSKFW
+>XP_002411541.1_Ixodes_scapularis
+VDCLTNCFRPILFYSTVLAHSVWSRRHRRDHARESDPAYSRRPPAPPLQAETRQPLECAF
+CKKNGERRSFARTHVLKDKLTGHVVCPILRKYKCEMCGATGDNSHTRSYCPQKPGEVFNM
+ALLKETPRNSTDRRKDSK
+>XP_002130327.1_Ciona_intestinalis
+MDYCVFNDYFGLSNILQREDRNNETQPPQQDIPSPTPHNGMAWLDEKCNEIIEKHTSMLT
+PPPTHSGALLGPTQNSGSLFRERGLLRHNHEDELTNSSMTSPPHTSNPTSPVVSPYPTTN
+ISLKQSSQRLKQPHVPRFSFPRYSNNRRGYPGCSFCRNNKEVDEWVTSHQLKDALNRVTC
+PVLRRYECPLCLASGDNAHTLGHCPLNPDRKSSLPLAVRLKTNATGKLKL
+>NP_001093313.1_Bombyx_mori
+MYPRKSLLYLNNNMLDVNKLFPTPMESDLLQTLLNPGRSPYNQSTPINSSSNDSTTPESL
+IDVSMKSFMKTDNDTPSAVRRHRPIFGRRIMIGDAQPTFEPTHTPSFETTLDKSLSNIWK
+EDNDSVFSQTPPKYYNNEYNYNNSEFYELFPKESRSAIGNNLMNNRNFSMTSSDLSLNMN
+TYQSQFTSANCSNMRASKPFGPTQFGPLTTPQVTFESSSRFPFNTKICSFCRKNGEAPNV
+YGTHTVRQKIGNRSVVMCPILRRHVCNTCGETGDNAHTITYCPILRRTNNGAPLQSTTIT
+LKNTRVKSNGRRRF
+>XP_003742380.1_Metaseiulus_occidentalis
+MFPPTINFPKIDNPWSNEMSPFSNVNPSDETSSGFRTIPESGRRSSSPELMTPTDNYPLD
+NVFSKQQTYPFHRTSAPFPRQQVSYLPETVNAAWQTMSHRVPAFEKSLPPRRYVFEAAHC
+CATPRIRVVHDCCNKESNPRELLDDRPVFHRRAYPSSAAKLTLCRFCLKNGEPPSVYYSH
+NLHAEDGRVSCPVLRRYDCPICNSGGGDYAHTVRYCPALRANIMR
+>XP_001850499.1_Culex_quinquefasciatus
+MATGEKIGMSMKPQTAIATSVAKHEKENKLNWQDQWELLKKSGQFCNFCKKNKELREIYQ
+SHDLKGPDGTVTCPVLKRCVCQCCGEQGHTIAYCPRNASGTSILQMINHHNRLPSSEKGH
+SANISEQMEPPGWRGLYCAGNVSAHV
+>XP_003742143.1_Metaseiulus_occidentalis
+MANYPVQLYFSPDYPDPLGDFRRGLRKQPPEGRTLSLIYQGESKKFAEEAQPQASSSAPE
+DLSHKKWSEIARSDLKVIDLPASSPEKLTPSGKPKTCCSFCLKNGEPVEHYSSHSLYTRD
+NVVACPILRTFRCNICGCEGGDYAHTKKYCPLVNNNRRIGILPETYRDPKNK
+>XP_003740383.1_Metaseiulus_occidentalis
+MNAANMRRGRDQNGQRRSSVGARNGSGSKSRRQEEAQLIPLASLDYCPFCLKNGEAAEEY
+RSHTLKNFFSKVTCPKLKTYRCQICHNVGGDYAHTTGYCPLRPTSKQSRDFHYLK
+>XP_001661762.1_Aedes_aegypti
+MSVSQETLDMITAAIKNGANVQGTLVRSKLTNRLVWNAEDNDENDPYRQYLSMIGGGHAT
+GQGKQLLHAGSAGGRTVLGEIQQHDNLNGRRNGKKHDKENWRDQWEILKKSGNYCSLCKN
+NKEGREIYLSHNLKGPNGEVTCPILMECDCPCCGQRGHTM
+>JQ397274.1_Clytia_hemisphaerica
+MIRSRESSLKATLERMDFTEKPQYNVFEDYLGLINLVCPATSTTDSTSSSPIPSPCGSVY
+DFATESSSMMHRHRMNSLDSDSLSDSSSSGESREDDLMFVYPPPPTKTIPRAPSPPMRAI
+LETPPYPPPSLETLIAQKAVLSRLQQIPMNPGPFHSSHHNRKNAAKATVCVFCRNNGESR
+EFYSSHTLKDSEGNTSCPILRAYTCPLCKANGDSSHTVKYCPKYTPKVKAEKLLHLNLGL
+HQL
+>Nanomia_bijuga_nanos-1
+XTLASCCESVTYPRVRVTIKISTKMLSSIIRNNEKDLKMDKEAFAAAAAFDKKVDESQFL
+VFHDYLGLINLVRPIGVFPSLESYSSKSDLVDYSPLFGFNQRQRMDDPLFGFNQRQRMDS
+LDSDAISDSSSGGCRSESDMLLESMSSNSDNSSTYGSKSTGSDVAQTYAQTLESIIAGQK
+NVINRLSLVSKDSRLAKNTSKATVCVFCRNNGESQEFFRSHTLKDSEGNTTCPILRAYTC
+PLCKENGDKSHTIKYCPKYTPKVKTDRLLVMPTX
+>AB037081.1_Hydra_vulgaris
+MTMTDVYMQNFVLKNIFETDDELDLWSSSDSSNSSECSPTFFSRSAKGINDFKLYKDYSG
+LSNLLTNVNISDDNPLVDGDHRLSFLPRNQIYNKLSNDPEGSDVDVYSPTRDLALRSRDN
+NNNFPDVKQLPPSTRLSKSDRDMIISGAFQQQLSFINKHSDRSQIKMNPPLQAPPSPALV
+QPQQTLYNSHDSLTLRASSNVCVFCRNNGESENVYASHVLKDTDGRTSCPILRAYTCPIC
+KANGDNSHTIKYCPMNQNARSASTFNGLSLPPSVNMAPRNTFPQPVRGNFRSPFPVNLTP
+RINLGAKIR
+>JQ397275.1_Clytia_hemisphaerica
+MSLMSEVMLQNYMADGWSSDGRSSSCSSSQSSESGSSLGNFSTGFSSFNDYFGLSNLLSN
+VKISDDNPLLQSTQKNLSLLQRARRQSWASDGSDNAAVLSPTIESQHSYDRFDMNNNDTK
+FPSRLPHSVRDHNLINSAYPPQNDSRADKLGKQPLIMPPSPPATNQPISMPLPPSQPQNR
+GASTNSNNNNGVQVCVFCRNNGESESVYTSHVLKDTDGRTSCPILRAYTCPICKANGDNS
+HTIKYCPMNQNARMMGQNGNNQGNAGLFPRPPFRAPFPPPPNMPAGLTQPNFQRNKNSFR
+>Nanomia_bijuga_nanos-2
+MSISDVVLQNFMPRSILESDDDLDTWSSGGRSSGSSQCSETGSYSSAKELRDPNDFRLFT
+DYFGLSNLLNNIKISEDNPLLHGSKNIFNNMQRARRISWESDSSDSGVVLSPTMDNPPCT
+YERSFESNGINVNVMNNNNIGTGVKQLPPPSMRLSKAERDHIISGAWQQNINNRQPIDKM
+PPPPPPSINGTQLPPPTSPRQPVVVPPPPSSVAPPPARPQSGLHVCVFCRNNGESESVYT
+SHVLKDSDGRTSCPILRAYTCPICKANGDTSHTIKYCPMNQNARVPSSIGGVMGPPQPPH
+AHPHPQHTQQSLNMGPPQRSYQPQRPANFRPPPFPANLAAAGRINPPTVKLRQ
+(XP_003743066.1_Metaseiulus_occidentalis:0.42371387192681847500,(XP_003748633.1_Metaseiulus_occidentalis:0.96155614135015265997,((((((XP_002576493.1_Schistosoma_mansoni:3.73185239652280076328,(XP_003243868.1_Acyrthosiphon_pisum:3.61913240794576163140,NP_001093313.1_Bombyx_mori:2.63292136335146365056)20:0.36751670885055659488)10:0.38253051136760590767,((NP_476658.1_Drosophila_melanogaster:2.53179644163674089086,(XP_001861874.1_Culex_quinquefasciatus:1.95720935518313021717,(XP_001655854.1_Aedes_aegypti:2.16920167630771265621,XP_316157.2_Anopheles_gambiae:3.44064914374649344353)53:0.41010420880960934964)76:0.97976831905154693203)31:0.45220579133231714186,XP_002576848.1_Schistosoma_mansoni:3.74876075317471357806)17:0.56902788503449863722)4:0.20842925825303532106,((((((((XP_003490239.1_Bombus_impatiens:0.14910000415555335618,(NP_001035321.1_Apis_mellifera:0.00000122123005994819,XP_003703618.1_Megachile_rotundata:0.44679899915879783823)94:0.35788144213368811020)87:0.51846013321480732827,NP_001128394.1_Nasonia_vitripennis:0.55187570479190439787)92:1.22325223689133255611,(NP_001073023.1_Strongylocentrotus_purpuratus:2.12083153838785287704,NP_001161595.1_Saccoglossus_kowalevskii:1.21962961708400241534)17:0.35055926861013236850)10:0.29721737156746674824,((XP_001641215.1_Nematostella_vectensis:1.91677118109852484551,((JQ397275.1_Clytia_hemisphaerica:1.04727259116163406993,(Nanomia_bijuga_nanos-2:1.04657328815438921410,(XP_002159764.1_Hydra_magnipapillata:0.00000122123005994819,AB037081.1_Hydra_vulgaris:0.01458069771158450149)100:0.93375797536248406061)78:0.42380300892056094186)81:0.64627816245737035317,((Nanomia_bijuga_nanos-1:1.59835844649657721206,(JQ397274.1_Clytia_hemisphaerica:1.34335558730599924360,XP_002161850.1_Hydra_magnipapillata:1.34110514885135967411)47:0.06916124663060371769)94:0.86299871516487547396,XP_001637175.1_Nematostella_vectensis:1.17187399108258638591)80:0.80356213258161601765)44:0.11156995481937162507)18:0.17361435353791698777,XP_003384296.1_Amphimedon_queenslandica:2.45450393752570272810)12:0.34967280870266898019)7:0.08699002856369805747,(((XP_003199884.1_Danio_rerio:0.20293905705756021263,(XP_003443401.1_Oreochromis_niloticus:0.05099531921596002493,XP_003970707.1_Takifugu_rubripes:0.02725961600302465385)64:0.07340003140185433206)95:0.45316718540091699419,(XP_003962918.1_Takifugu_rubripes:0.27290269451524185040,XP_003447814.1_Oreochromis_niloticus:0.21376377317219888430)74:0.24451317515828646654)92:0.97712928292168810263,(((XP_003641548.1_Gallus_gallus:0.50324051979908557275,XP_001376960.1_Monodelphis_domestica:0.58753643167794233904)60:0.30731465649847405919,(NP_848508.2_Mus_musculus:0.19082200775435750884,(XP_003433634.1_Canis_lupus:0.15478777853381583962,((NP_955631.1_Homo_sapiens:0.01954535781286924692,(XP_002915453.1_Ailuropoda_melanoleuca:0.76874901477321300192,XP_002756490.1_Callithrix_jacchus:0.00000122123005994819)92:0.31472374229652616551)76:0.05478652558262885747,XP_003904371.1_Papio_anubis:0.18478226878657641463)59:0.04837710967475377516)48:0.02026627504194071852)75:0.47739703432460323107)59:0.72458145602661971907,NP_988857.1_Xenopus_tropicalis:2.24260300263238843144)65:0.85432593008092594378)49:0.99800237668970515070)8:0.07085614677832970110,(XP_002114667.1_Trichoplax_adhaerens:0.76805819056684510038,XP_002608940.1_Branchiostoma_floridae:1.86492090423518708242)20:0.35256227246177840318)10:0.20068675991711149020,XP_002130327.1_Ciona_intestinalis:2.97999272186143349117)4:0.09026628342380174641,(((XP_003242523.1_Acyrthosiphon_pisum:2.68462229668925500548,XP_002411541.1_Ixodes_scapularis:2.22169361751181382303)50:0.47852700534442632607,((NP_001098700.1_Bombyx_mori:1.88367666247731757601,NP_001098702.1_Bombyx_mori:1.46996595923670447803)84:0.85498249234135859087,NP_001093314.1_Bombyx_mori:2.19499833606450689416)50:0.75708922361766917142)14:0.37512058621856408935,((XP_001850499.1_Culex_quinquefasciatus:1.08641342314155719961,XP_001661762.1_Aedes_aegypti:1.30581525119494057385)99:2.88798918193843290325,((((NP_571953.1_Danio_rerio:0.80506957635695064468,(XP_003455853.1_Oreochromis_niloticus:0.66216553094661656509,XP_003972111.1_Takifugu_rubripes:2.50703367213168393235)46:0.55967729434372603947)87:1.29525739767492664711,((XP_002921037.1_Ailuropoda_melanoleuca:0.00000122123005994819,(XP_003432960.1_Canis_lupus:0.10358228197537812376,((XP_001494869.1_Equus_caballus:0.31259618059498084364,NP_918948.1_Mus_musculus:0.41803132766709361068)20:0.09713285654026000693,(NP_001092092.1_Homo_sapiens:0.00840645159379999236,(XP_002828811.1_Pongo_abelii:0.01531361143936516879,(XP_003275656.1_Nomascus_leucogenys:0.01224021321691802153,((((XP_003915072.1_Papio_anubis:0.07860237417149289196,XP_001111100.2_Macaca_mulatta:0.09904274342461932834)97:0.05352917369945175974,(XP_002761839.1_Callithrix_jacchus:0.20335066021627193344,XP_003941756.1_Saimiri_boliviensis:0.11301049446573255275)55:0.12370634232841654088)31:0.10018679021692417086,XP_001171060.1_Pan_troglodytes:0.00000122123005994819)20:0.00557859990981566904,XP_004060189.1_Gorilla_gorilla:0.00000122123005994819)12:0.00555371869654670662)18:0.00262930924989153696)30:0.04446898831505383815)91:0.31017878904843776411)39:0.04279088842357939987)48:0.24060551385965570081)72:0.76296061662136793746,XP_001377519.2_Monodelphis_domestica:1.02239010659776319301)93:0.66980794950318001124)49:0.34113812213436495169,(XP_003439364.1_Oreochromis_niloticus:1.57982626853760765862,XP_003968060.1_Takifugu_rubripes:0.89966242209981228672)89:1.44857376028637396814)13:0.33993525566806948035,(NP_918953.2_Mus_musculus:0.48776216051421900088,(XP_004061051.1_Gorilla_gorilla:0.00000122123005994819,(NP_001025032.1_Homo_sapiens:0.01398526718191062113,(XP_002829477.1_Pongo_abelii:0.00000122123005994819,((XP_003915791.1_Papio_anubis:0.02802941737590342736,XP_001111556.1_Macaca_mulatta:0.00000122123005994819)92:0.04302327558591714785,((XP_002762341.1_Callithrix_jacchus:0.09167549269872971029,XP_003940311.1_Saimiri_boliviensis:0.01411674200632852434)77:0.06431034113610609171,(XP_001363834.1_Monodelphis_domestica:1.02868351493532994567,(XP_001502873.1_Equus_caballus:0.06579863927515737509,(XP_002928544.1_Ailuropoda_melanoleuca:0.13803998828239200103,XP_541547.1_Canis_lupus:0.07142854725791648873)73:0.03439869691818116942)70:0.08901620678483379567)31:0.13806416189815556850)23:0.03174352968182370116)9:0.00000122123005994819)5:0.00000122123005994819)11:0.02865018480643170828)41:0.36175480969372658668)96:1.39913423830412608773)24:0.40383586510077817966)6:0.29629304777919490688)3:0.18627206205646235082)1:0.21832514292748161910)18:0.13671895211611084786,(XP_003740383.1_Metaseiulus_occidentalis:3.71193934560846461324,XP_003742143.1_Metaseiulus_occidentalis:2.44789361169522612371)57:1.57469995845552412916)11:0.00000122123005994819,XP_002434012.1_Ixodes_scapularis:2.81922858069004034220)17:0.35940052905547764661,((XP_003742380.1_Metaseiulus_occidentalis:2.32162756631444100464,XP_003740500.1_Metaseiulus_occidentalis:2.67793839582499115792)58:0.58688575410124477205,XP_003745542.1_Metaseiulus_occidentalis:2.70071848375645640061)25:0.39049793543289607056)75:1.56243038755239505022)99:2.05290661864771584177,XP_003743067.1_Metaseiulus_occidentalis:0.47745919384989310430);

File original_sequences.fasta

+>Nb_piwi
+TCAGCTCGTTTGGGAAGATATCGATACATATATCCGCTGCATCAAGATTTAACTCGTAATGGCGAGTTGTTAAAATGTCACGAGTTACATTTTCTCTTAGTTATGAAATAAGTTATTCTCTTTAGGTTGATATCTTGTTTGGATATTAGTATTAGCGAGCCACTTGACAAGGGAAAATAAATCAAAATGACAGGAAGAGCACGAGGTCGATCCCGAGGAAGAGGTAGATCAGATGGAGCCACTCCTGGTGCTGGTACTCCACAACCAGCCAGACCAGCCGGTGCACCACAAGTTGGCCGTGGACGATCACGAGGTGCAGCACCCACCCCTCAACAAGCTCAAGCCCCACCGCAGCAGAGAGGACCTCCTCCTGCTGCAGCCCCAGCTCGTGCAGCTGCACCACCTGCCGAACAGATGGCTAAAATGACAGTATCTGACAACAAGCCACAACAGCAACAACGAGAACAGAGAAGAAGAAAATTTGATGGTGAAGATCACACCCTGGTAACAAGAAATGATGGACAGGTGAAAGAAGGTACAGCTGGACAGAAATGTTCCATTGTTTCAAATTTCTTTAAAGTTAAGAAATTGCCTGTCTTCACTGGTTTGTTTCAGTACAATGTTTCATTTGATCCTGATATTCAGAGTAATAAACTGAAAAGTGCTCTTCTTCATGATCTTGATGATATTCTTGGAACAACAAGATGCTTTGATGGCATGACGATGTTTCTACCAAAGAAATTGGAAGAACCAACAACAACGAAAACTGTCACTACGCGTCAAGGCAATGATATTACAATAAAGATCATGTTTACTAATGCAGTACCTGAGAATTCTCCTAGTGTTGTACAGCTGATGAACATCTTATTTAGAAAACAACTTCGGGCAATGGACATGCAACTTGTTGGTCGCAATTACTACCATCCTGATAGAAAAATTGACATCAAAGCTCACAAAATGCAGGTTTGGCCAGGTATCAGCACTTCCATTCTTCAATATGAGAGTGATGTCATGCTGTGTGCTGATGTTGCTCACAAAGTTTTGAGAATGCAAACTGTTCTTGAATTTTTGTATGAAATATACAATACTTGTAATAACAAGCAAGGATTTTATGATATTGCCAAGAAGAAATTGCTGGGTGAAATAATCCTTACGCGCTACAATAATAAGACATATAGAATCGATGACATCGACTGGGAGAAACATCCAACAGATAGTTTCCAGAAAGCAGATGGATCAAGCATAACATTCAAAGAGTACTATGAAACAGTCTATGAGAAAAAAGTCAATGATCTAAAGCAGCCTTTGCTTATTTCGAGACCAAAAGAGAAAGACCGCAAAAGAGGAATGGATGGACCAATTTTACTGTTACCTGAATTTTGCGTCATTACTGGTTTGTCTGATGAAATCAGAGCTAACTTTGGTATCATGAAGGATTTAGCGCAGCACACAAGAATTTCACCAGCTGCAAGAGCACAAAATCTTACTCAATTTATGAGTGACCTGCATGCAAACCCAAAAGCACAGGCCGAGCTCCAGCAATGGAATATGGAATTTGAGCGACAGCTTCTCAAGATGACTGGACGTTGTCTTGGTGCAGAAAAAATGTTCCAGAAGGATGCCGTATTTTCTTACAAGATTCAAGATGCTGATTGGAGTAAGGAAACTAGAGGAAAAGCTCTAATTACTACTGTCAATCTCCAAAACTGGGTCTTGTTACACACTCAAAGGGATCAGCAAGTTGCTCAGGGATTTGTTCAAACCTTAAAAAGAGTTTGTGGACCTATGGGTATGAATGTTGCAGAACCAACTGTATGTCGTCTCAATGATGACCAAGCTCGGACATATTTTAATTCATTGAATGACCAGATCACTCAACAAGTTCAAATGGTTGTCTGCATTGTTCCAAATAACAGAAAGGATCGCTATGATGCTATTAAGAAGTTGTGTTGTGTTGAGAAACCTGTGCCCTCACAAGTTGTTGTGGCTCGTACCATTCAAAAACCACAGATGTTAATGAGTGTATGTACCAAGATTGGTATCCAGTTGAATTGTAAACTTGGCGGGGAAGTTTGGGCGGTTGATATCCCATTGAAGAAATTGATGGTTGTAGGGTTTGATGTGTATCATGATTCTTTGACTAAAGGGAAATCCATTGGTGGTTTTGTTGCTTCAACGAACAAACATCTTACCAGGTACTATTCAAGAACAACTAGCCAAACCAGTCACCAAGAAATTGCTGATCAACTTAAAGTTTGCATGATCAGTTCATTGAAAAAGTATCATGAGATTAATCAATGTTTGCCTGATCCAGTTATTGTTTACAGAGATGGTGTTGGTGATGGCCAGATTAAACAAGTGTACGATCACGAAGTTCCACAATTCAAAGAGGCCTTTGCCCAAGTTGAACCGAACTACAACCCAAAATTTGCTATGATTATTGTCAAAAAACGTGTGTCAACAAGATTGTTCCTCGAAGAACGAAACCAATTTGGTAACCCTCCTCCAGGTACCTTGGTTGATTCAGTAGTTACAAGACCTGAGTGGTTTGATTTCTTCCTCGTATCACAAAGTGTACGTCAAGGAACAGTCACCCCAACACATTACAATGTTATCAATGACTCAAGTGGCTTCAAGGCTGATCACTTCCAAAGATTGACTTACAAATTGTGTCATTTATACTACAATTGGCCGGGAACCATTCGTGTACCAGCTCCGTGTCAATATGCTCATAAGCTTGCCTTCTTAGTTGGACAATCGATTCACACAGAACCTGATGCAAGTTTGGCTGACCGATTATACTATTTGTAGACTAGTAGTTTTAAGGTGTTGGTTTGATGGATTTCGATTCGTGTGCAGAGATTTTTATATCACACATTCATTCATGTATATATGTAGCATTTTATATCGATACGTCAAACTCAGAACTAAACCGATTTATTATTGGATACATTCATCAGAACACTAGATATTTATTTACGTAAATGGGGTATCTGTGTATGACTGAAGCAAGTTTGTTTCGTTATTGTACATATTTAGTTTCCTTCTGTGGGGTAAATAGATTTATAATATGACATAGTCATCTATATATTTTTCACCAGGTTACATTCAATATTGTTGCTTAAAAGTATAGCTTTCTTCATCTACCCTTCTAATCCAATTGATGATCAAATATTCAGTGTGCCGTTTTTCTTGAATATCGAACATTGTGTCCGCATTCAGATTTAACGGGATGATAGTGAAGCAGTATAGTCAGCCAAAGTATTCAAAATTCTGCTATAGGTGGATGGATCTTGTGTTTTGTTTTCTTGTAAGTGACGTGATTTTGTTTAATTTGTTTTGCTATGTTGAGAGTTATGTGCATGGAAAACCATAAAAGAACCTACGAATGTGATGTAGACATTTTAATAGTCCACTGTTTTCTTTATACTATATTACAACGATATATTTTATGTTCAAGTTCAAGAACAAACCAAAAGTCGCTTGAGATTCGTTTTAGACGAGGGTAGAGAAAGCTGGCTGATTGCACAACATTGTTATTTATTTTTTAATTTAAGCTTTTTGTATATATTTTGAATATTTTTGATAGGTTCCAAGCCTAGTCTATCCATAAGTGCTGATTCTTCAGAGTCGGATAGCGATGTTAAGTTTTCAATACCTGTTTTTGCAGTGTTTTTATCCGTTCATATTTGCCACAAATTTTTACTTAGGTCCTTTTTACGTGCTCGCCTCGTAAGGTTCTATGGCCGGTATTCCGTAATTACTTGTTGTTCTCGGTTAATTCTTGTCGTTTTAATAGAAAGTTCTATGAGTTTAACCACAACGGAATATCGGCTTACACTCGGTTACATACATTTAACATTAGGTATATTGTTACAATTGTTAGTTATGCATAAACAAGATTTTTAAGATCAGTAACTGTACTTCATTTAGTTGGAAAAGTTCAAACTAAGGCATTAAATTTA
+>Nb_nanos-1
+GAACACTCGCTAGTTGCTGTGAATCTGTTACTTACCCACGTGTACGTGTAACTATTAAGATATCAACAAAGATGTTAAGTTCGATTATTCGAAACAACGAGAAAGATCTCAAGATGGATAAAGAAGCGTTCGCTGCTGCTGCAGCATTCGATAAGAAAGTAGATGAAAGTCAATTTCTTGTCTTCCACGATTACTTAGGACTTATTAATTTAGTTAGACCGATTGGAGTATTCCCGTCGCTCGAATCATATTCTTCAAAATCTGATCTAGTCGATTATTCACCGTTATTTGGTTTCAACCAGCGTCAACGAATGGATGATCCGTTATTTGGTTTCAATCAACGTCAACGAATGGATAGTTTGGATTCAGACGCCATCAGTGATAGTTCGTCTGGTGGTTGTCGGTCAGAATCCGACATGTTATTAGAAAGCATGAGTTCGAATAGTGATAATTCAAGTACGTATGGATCAAAATCAACGGGCAGTGATGTTGCCCAGACATATGCACAGACATTGGAATCTATAATTGCTGGACAAAAGAATGTTATAAATCGTCTCTCACTTGTTAGCAAAGACAGTCGTCTTGCTAAAAATACATCAAAAGCAACCGTATGTGTATTCTGTAGGAACAATGGTGAATCACAAGAATTTTTCAGATCACATACATTAAAAGACTCCGAAGGTAATACTACATGTCCTATATTACGTGCTTATACTTGTCCGTTATGTAAAGAAAATGGAGACAAAAGTCATACAATTAAATACTGTCCTAAATATACACCAAAAGTTAAAACCGATAGATTATTAGTTATGCCTACTAT
+>Nb_nanos-2 AGTTATTAATTTTATTAAAAATGTCTATTAGCGACGTTGTATTACAAAATTTTATGCCGAGAAGCATTTTAGAATCGGACGATGATTTAGACACATGGTCGTCGGGTGGAAGGAGTAGTGGGAGCAGCCAATGCAGTGAAACCGGTTCGTACAGTTCCGCCAAAGAATTGAGAGATCCTAACGATTTTCGTTTATTTACAGATTATTTCGGACTTTCAAATTTATTAAATAATATTAAAATATCTGAGGATAATCCTTTATTACATGGATCAAAGAATATTTTTAATAACATGCAACGTGCAAGAAGAATAAGTTGGGAAAGTGATAGCAGTGATTCCGGAGTCGTGCTTTCTCCGACGATGGATAATCCTCCTTGTACATACGAGCGAAGTTTCGAATCTAATGGTATCAATGTTAATGTTATGAACAACAACAACATCGGAACTGGCGTTAAACAGTTGCCACCTCCAAGCATGAGACTCAGCAAAGCCGAAAGAGATCACATTATCAGCGGAGCATGGCAACAGAACATCAACAACAGACAACCAATTGATAAAATGCCGCCGCCACCACCACCATCTATCAACGGAACGCAACTTCCACCGCCCACTTCACCGAGACAACCTGTAGTTGTCCCACCTCCACCATCAAGCGTGGCACCACCACCCGCCCGCCCACAATCTGGTTTACACGTGTGCGTGTTTTGTCGTAACAACGGTGAAAGTGAAAGCGTCTACACAAGTCATGTGTTGAAAGATTCAGATGGTCGTACTTCGTGTCCAATCCTGAGAGCGTACACATGTCCTATCTGTAAAGCAAATGGCGATACCTCACATACGATTAAATATTGTCCGATGAACCAGAATGCACGTGTACCATCTTCGATCGGAGGCGTGATGGGTCCACCGCAACCGCCCCATGCCCATCCCCACCCCCAACATACGCAACAATCTCTTAACATGGGACCACCACAAAGAAGTTATCAGCCGCAGAGACCAGCCAATTTTCGTCCACCACCATTTCCTGCTAACTTGGCCGCTGCTGGAAGAATCAATCCACCAACGGTTAAATTAAGGCAGTAAGT
+>Nb_PL10
+AGGTCAACAACAGCCTTTTTCGTGGCATTCTGAACGTGGTGCTCGATGGGAGAACAATGATAACAGAAATGCAGAAGATTGGTCAAAGCCATTGCCACGAAATGAGAGACTAGAAAGCGAGTTGTTCACTTCGGCAGTATCAGGTATTAATTTTGATCGATATGAAGACATTCCTGTTGAAGCAACAGGAACTGATGCACCAAACCCAATTGACTCTTTTGAGGATGCCAATCTTGGTGAAATTATCACATCTAACATTCAGTTAGCAAAGTATTCAAAGCCAACACCTGTTCAGAAATATGCTATTCCTATCATCAAAGGAAAGAGGGATCTTATGGCATGTGCCCAGACTGGTTCTGGTAAAACTGCTGCATTTTTGGTTCCTATTCTCAGTCGTATTTACGAAGAAGGTCCTTTTGAAAATCAATCCCAAAATATGTCAGGTGGAAGAAGGAAGCAATTTCCTTTAGCTATTGTTTTAGCACCAACAAGAGAACTGGCTTCTCAAATTTATGATGAATCTCGAAAGTTTGTCTACAGGTCGTGTATTAGACCATGTGTCGTTTATGGTGGTGCTGATGTTGGTACACAAATGAGAGACCTTGATCGTGGTTGTCATATTTTGGTTGCAACTCCTGGACGATTGGTTGATATGATCCAGAGAGGTAAAATTGCTTTAGAATGCATTAAATTTCTTGTGCTTGATGAAGCTGACAGAATGCTGGATATGGGTTTTGAACCACAGATTCGTGAAATTGTTGAGAAGAATGACATGCCTGGTGTGGGATCTCGACAGACTTTCATGTTCAGTGCTACATTCCCTAAAGAAATCCAGATTTTGGCTAGAGACTTTTTGAAAGACTACATCTTTTTGGCAGTTGGACGTGTTGGGTCCACTAGTGAAAATATCACCCAGAAAGTTGTATGGGTAGAAGAACATGACAAAAGAGAATTCTTGTTGGATTTACTCAATGCTTCAGGTCCTGATTCATTGACTCTTGTCTTTGTGGAGACTAAACGTGGTGCTGATGCACTAGAAGACTTTTTATGCCGGTGTGAAGAATGTTACAAAGTGTCTTCCATTCATGGTGATCGTCATCAACGCGAAAGGGAGCAAGCTTTGTCTTCATTTAGAAATGGTGTTACACCTATTCTTGTAGCAACTGCTGTTGCAGCTCGTGGTCTTGATATCCCTAATGTCAAGCATGTTGTTAACTTTGATATGCCAAGTGATATTGAAGAATATGTCCACAGGATTGGGCGTACAGGTCGTGTTGGTCACACAGGATTAGCCACTTCTTTTTTCAATGAGAAAAACCGAAATATTGCACGTGATTTAATTGATACTTTGTCAGACAGTAAACAAGAAGTTCCCTCGTGGTTGGAGTCAATGGGCTACCAAGCACAACAACATCAAGCAGCTAAAAGGGCTCAGAAAAATAGATATAATGGAGGATCATTTGGTGGACGAGATTACCGTCAACAAATGGGACGTGGAGGAAATAGTGGCGGCGGCGGCGGTGGAGGTAATAACTTCTACAATCCACAAATGCAATATGGTGGAACTCCATTCAATGCATACAACCAGCAACAGGCACCACCTGTTTACCAACAGGGCTTCCGTGGAGGTGGCAACATGCGTGGTGGCGGCAGTATGAACAACCGTGGTGGAAGCCGCAACCAAAGTGATGACTGGTGGGATAAATA
+>Nb_vasa-1 ACGTTGTCAACAATCAGGACATTTTGCAAGAGACTGTGAAAATGAACAAGTGCTTGATCCTGATCGACCAGCTCCAGTCACTTATGTTCCTCCAGAACCATCTGAGGAAGAAGAAGAAATGTTCCGGACTATTGCTCAAGGAATCAACTTCAGTAATTATGATAATATCCCTGTCGAGGTTACTGGTCCAGGAAAAATGGCAAGTGCAATCAGAAGTTTTGAAGAAGCAGATCTAGGAGAAACAATCATCAGTAATATTGCCAAAGCTAAATATTCAAAACCAACTCCAGTACAAAAATATGCTTTACCCATAATATTAGATGGACGTGATCTTATGTCTTGCGCACAAACTGGGTCAGGAAAAACAGCTGCTTTCCTTTTACCTGTTATTGCTAATTTACTTAAACATCAAGATGAGTTTACAAGTCAACTTAGTGAGGTGCAAGCACCTCTAGCTATGGTTATTGCTCCAACTCGTGAATTGGCTGATCAGATCTACCGCGAAGCACGTAAATTTTCTCAAAACACAAGTCTTAGACCAGTTGTTTGTTATGGTGGTGTGTCTGTTGCACATCAATTGAGGCAAGTTCAGAGTGGTTGTCACTTACTTGTTGGTACACCTGGAAGATTAAAGGACTTTATTGGAAAGAGAAAGATTTCTCTTGAGAAGTTGAAGTATTTAATCCTTGATGAAGCTGATCGTATGCTTGATATGGGTTTTATGCCAGATGTTAAAGAACTCATCTACCAACACAATATGCCTGAAAAAACTGAGCGTAACACACTTATGTTCAGTGCTACATTCCCTGAAGAAATCCAAAAGTTAGCTGCTGAATTTTTGAGAGAGTATGTTTTCTTGACTATTGGTAAAGTTGGAAGTACACATTCAGATATTGAACAAGCAGTGATGGAGGTTGACGATTCATCCAAAAGAGACAAGTTGGTTGAAATTCTTGGTAATGAGGGTGTTAACCGGAATCTTGTATTTGTTCAAACAAAAAGATTGGCTGATTTCCTTGCCAGTTATCTGTGTCAAAATGGATTCCCCACTACTAGTATTCATGGTGACAGACACCAAGCCCAAAGAGAAGAAGCTCTTCGGGAATTCCGATCTGGTCAACAAACAGTCCTTATTGCTACTGCAGTTGCTGCTCGTGGTCTTGACATCGCTGATGTGAAGCAAGTCATCAATTATGATTTACCTGATGAGATAGAAGAATACATTCATCGTATTGGGCGAACAGGACGTATCGGAAACAAAGGAAAAGCTATCTCATTTTTTTCAAGAGGAAGAGATGAGCAACTTGCAAGAGCAATGGTTAAAACACTTGCTGATTCAGAGCAAGTTGTACCTGATTGGCTAGAAGAAGTTGCTGAAACTGCTCTTGGTACAGGTTATGGTCCTAAAGGAGGAAGATTCGGTGGTAAAGATACCAGAGGCGGAGATATGGGTGGTGGCGGCGGTACATTTAACGCTGCATCGAATGATGATGGCTGGGATCAAAGTAATGGTGCTAGCAACGGGAATGGAG
+>Nb_vasa-2
+ATAATAAAACTTGGCCTGACTATGTTTGCAGCACTTAAATCGGGTGCACCTCTACCAGTCATTCCAAAGTCAGCTCCTCCTGCAGCTGCGCCTCAAGGTGACTCCAATTCTGGATTCCAGAGAAATGATAGAGGTGGTGATAAAAATCTTCAAGCAAAAGTTTTCAATATACCTGAAGGAACAGAAGATAATGACTTACGAAATCACTTCGCATCATGTGGTGAAGTTACTGGTGTAAAGATTCTTCCAATTCGTGATGGTAAAGTTACTACTCTTGGATTTGTGACATTTACTGACATGGATGGTGTTCGCAAGGCTTGCAGTGAAATGAATAACATTGAATTCAACGGATCGCCATTACGAGTTATGGAGAACACACCTCCTGGTGGTGGTGCTAGCATTAGCAACAACAGTGGTGGACGAATGGGAGGTGATAATTGTCAGTGCAAAGTATACAACATTCCTGAATCGACTCAAGAGGAATCTCTCAAAGCTTATTTTGGCGCTATTGGTGAGGTCACCAGAGTAAAGATACTTCCATGTCGGGAAGGGAAAGATGTAACACTTGGGTTTGTTTCATTTGCATCATCTGATGATTGCAATCGAGCTGTATCTGAACTCAATGAGAAGGAATTTAATGGATCAAATTTACGAGTTCAGTCAGCTGACGGTGGAAGTGGCGGTGGTGGCGGTAGTTTTAGTGCTGGTGTTAGTACAGGAACATTCATGAATGGTTCAGGTAATGGACATGGAAATCAAGGCAATGGAGTTGATGCTGATGAAAGACCACAGCGTGGATTTGGGAGAGGTGCACAAATGTTGATGAATGCTAATCAAACAAATGGTGCCCCAGGAGGTAGACCTTCAGGAGGAGCCAGAGGACCCCAAGCTAAAGTTTTTGGAATTCCTGAAGGAACAGATCATAACGAACTTAAAGAATTCTTTGCATCTGCTGGTGAAGTGAAATTTGTTAAAGTTCTACCTCTTCGTGAAGGAAAAGATAATTGTTTAGGTTTCATTGAATTTGCCACTGACAGTGAAGTTGAGAATGCTGTAAGTACATTTGATGGTCAGGATTTCAATGGAAGCACTTTAAAAGTAATGGTGGGACAATCAGGTGGTGGTGGTGGTGGCAACTTCAATGGTGGTGGTGCACCCTGGGGTAATAATTCATCTGGACCTACTATGAGATTGCCTAGAGAAGAACAAATGCCAAGAGGTGAAATGAACGGTGGTGGTGGAGACATCATGCTCCCTGAAGGTGGTTCAAACAATGCCTGTCGACGATGCGGTGAGGAAGGTCATTGGTCGAGAGAATGTGTCAATGCACCGATGGCAAATAGCACACAAGCTGTCACTTATATCCCGCCTCCACCCCCTGAAACTGAATCTGAGATTTTTGAACAAGGCGTTCACCAAGGAATCAACTTTGATAATTTTGACTGCATTCCAGTTGAATTCACTGGTAATAATGCTCCTAAACCAGCTGGTTCATTTGCTGCAGCTAACTTACATGAGAGATGCTTGAAGAATATTGAACGATCGAAATATACAAAACCAACTCCTGTACAAAGATATGCTATCCCTACCATTATTGCACAACGGGATCTTATGGCTTGTGCGCAAACTGGTTCAGGAAAAACTGGTGCGTTTTTACTTCCGATGATAACAAACTTATTAAATGAAGGTGTATCATCCGAAACATCATGTGGAGGACCGGTATACCCCAAAGTCTGTATCCTTTCTCCAACTCGCGAACTCACAATCCAAATCTTCCACGAAGCGAAACGATTTTCGTACAATACAAACATCAAACCTGTTGTTGTGTACGGTGGTGTGAGCGTCAACCATCAAATATCTCGATTGGAGATGGGATGTCATATCCTTGTTGCAACACCAGGAAGATTGGATGATTTTGTGAAAAGAGGACGAATTAACTTCAAAGATCTTCAATATTTGGTACTTGATGAAGCTGACAAAATGTTAGATATGGGATTTGGTCCACACATTGAGCAAATTATCAACAACTCCGAAATGCCACCTAAAGGACGCCGTGTAACACTTATGTTCAGTGCAACATTCCCAGAAACGATCCAACAGATGGCTGCCAAGTTTTTGAACGATTATTTATTCTTGACAGTTGGACGTGTTGGAGGAACGTGTTCAGATGTCAAACAAGTCATTATGGAAGTTCAAGGCTCGCAGAAGAGAAATACACTTGAACAACTATTAGCTACAAGTGGAACTGACAGAACGTTGGTATTTGTTGAAAGGAAGAAGGATGCTGATTTCCTCGCAAGTTTCCTATCACAAAGAGATTATCCAGCAACCAGTTTGAATGCGGATCGTTCACAACAAGAGCGTGAAGAAGCTTTAGCTGATTTCCGTAGAGGGAAAGCACCTGTTCTCGTTGCGACAGCTGTTGCTGCTCGTGGTCTTGATATCAATGATGTCAAACATGTAATCAATTACGATTTACCTTCGGATGCGACAGAATACGTCCATCGTATTGGTCGAACAGGAAGAATTGGAAACAAAGGTTTAGCTACATCTTTCTTTGACGCTGGTAGAGACCAGAAACTTGCTCGTGGATTAGTGAAACTCTTGTCTGAGGCTGAACAAACTGTTCCTGATTGGTTAGAAGAAACTGCCTTGAAAGCTGTCGGTACTGGTTATGGCGCTGATAACGGACAGTTCCGTGACACAAGACCTCGCTTCGGTGGAAATGGAGGCGGTTATAATGGCAGTGGTGGTGGCGGCGGCGGTGGGTCCGCTCCACAACGTAAAGTAGTCGTGGATGATGACGATGAAGAATGGTAA
+>NP_004755.2_Homo_sapiens_piwi-like1
+MTGRARARARGRARGQETAQLVGSTASQQPGYIQPRPQPPPAEGELFGRGRQRGTAGGTA
+KSQGLQISAGFQELSLAERGGRRRDFHDLGVNTRQNLDHVKESKTGSSGIIVRLSTNHFR
+LTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGKCHAFDGTILFLPKRLQQKVTE
+VFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYYNPNDPID
+IPSHRLVIWPGFTTSILQYENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVS
+KELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQP
+VLVSQPKRRRGPGGTLPGPAMLIPELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQRE
+VGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSK
+ETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEVDDRTEA
+YLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVARTLGKQQTVMAI
+ATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFS
+RCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQF
+LDCLKSIGRGYNPRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIV
+SQAVRSGSVSPTHYNVIYDNSGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAF
+LVGQSIHREPNLSLSNRLYYL
+>NP_689644.2_Homo_sapiens_piwi-like4
+MSGRARVKARGIARSPSATEVGRIQASPLPRSVDLSNNEASSSNGFLGTSRISTNDKYGI
+SSGDAGSTFMERGVKNKQDFMDLSICTREKLAHVRNCKTGSSGIPVKLVTNLFNLDFPQD
+WQLYQYHVTYIPDLASRRLRIALLYSHSELSNKAKAFDGAILFLSQKLEEKVTELSSETQ
+RGETIKMTITLKRELPSSSPVCIQVFNIIFRKILKKLSMYQIGRNFYNPSEPMEIPQHKL
+SLWPGFAISVSYFERKLLFSADVSYKVLRNETVLEFMTALCQRTGLSCFTQTCEKQLIGL
+IVLTRYNNRTYSIDDIDWSVKPTHTFQKRDGTEITYVDYYKQQYDITVSDLNQPMLVSLL
+KKKRNDNSEAQLAHLIPELCFLTGLTDQATSDFQLMKAVAEKTRLSPSGRQQRLARLVDN
+IQRNTNARFELETWGLHFGSQISLTGRIVPSEKILMQDHICQPVSAADWSKDIRTCKILN
+AQSLNTWLILCSDRTEYVAESFLNCLRRVAGSMGFNVDYPKIIKVQENPAAFVRAIQQYV
+DPDVQLVMCILPSNQKTYYDSIKKYLSSDCPVPSQCVLARTLNKQGMMMSIATKIAMQMT
+CKLGGELWAVEIPLKSLMVVGIDVCKDALSKDVMVVGCVASVNPRITRWFSRCILQRTMT
+DVADCLKVFMTGALNKWYKYNHDLPARIIVYRAGVGDGQLKTLIEYEVPQLLSSVAESSS
+NTSSRLSVIVVRKKCMPRFFTEMNRTVQNPPLGTVVDSEATRNEWYDFYLISQVACRGTV
+SPTYYNVIYDDNGLKPDHMQRLTFKLCHLYYNWPGIVSVPAPCQYAHKLTFLVAQSIHKE
+PSLELANHLFYL
+>NP_001008496.2_Homo_sapiens_piwi-like3
+MPGRARTRARGRARRRESYQQEAPGGPRAPGSATTQEPPQLQSTPRPLQEEVPVVRPLQP
+RAARGGAGGGAQSQGVKEPGPEAGLHTAPLQERRIGGVFQDLVVNTRQDMKHVKDSKTGS
+EGTVVQLLANHFRVISRPQWVAYKYNVDYKPDIEDGNLRTILLDQHRRKFGERHIFDGNS
+LLLSRPLKERRVEWLSTTKDKNIVKITVEFSKELTPTSPDCLRYYNILFRRTFKLLDFEQ
+VGRNYYTKKKAIQLYRHGTSLEIWLGYVTSVLQYENSITLCADVSHKLLRIETAYDFIKR
+TSAQAQTGNIREEVTNKLIGSIVLTKYNNKTYRVDDIDWKQNPEDTFNKSDGSKITYIDY
+YRQQHKEIVTVKKQPLLVSQGRWKKGLTGTQREPILLIPQLCHMTGLTDEICKDYSIVKE
+LAKHTRLSPRRRHHTLKEFINTLQDNKKVRELLQLWDLKFDTNFLSVPGRVLKNANIVQG
+RRMVKANSQGDWSREIRELPLLNAMPLHSWLILYSRSSHREAMSLKGHLQSVTAPMGITM
+KPAEMIEVDGDANSYIDTLRKYTRPTLQMGMSCLLVFKVICILPNDDKRRYDSIKRYLCT
+KCPIPSQCVVKKTLEKVQARTIVTKIAQQMNCKMGGALWKVETDVQRTMFVGIDCFHDIV
+NRQKSIAGFVASTNAELTKWYSQCVIQKTGEELVKELEICLKAALDVWCKNESSMPHSVI
+VYRDGVGDGQLQALLDHEAKKMSTYLKTISPNNFTLAFIVVKKRINTRFFLKHGSNFQNP
+PPGTVIDVELTRNEWYDFFIVSQSVQDGTVTPTHYNVIYDTIGLSPDTVQRLTYCLCHMY
+YNLPGIIRVPAPCHYAHKLAYLVGQSIHQEPNRSLSTRLFYL
+>NP_060538.2_Homo_sapiens_piwi-like2
+MDPFRPSFRGQSPIHPSQCQAVRMPGCWPQASKPLDPALGRGAPAGRGHVFGKPEEPSTQ
+RGPAQRESVGLVSMFRGLGIETVSKTPLKREMLPSGRGILGRGLSANLVRKDREELSPTF
+WDPKVLAAGDSKMAETSVGWSRTLGRGSSDASLLPLGRAAGGISREVDKPPCTFSTPSRG
+PPQLSSPPALPQSPLHSPDRPLVLTVEHKEKELIVKQGSKGTPQSLGLNLVKIQCHNEAV
+YQYHVTFSPNVECKSMRFGMLKDHQAVTGNVTAFDGSILYLPVKLQQVLELKSQRKTDSA
+EISIKIQMTKILEPCSDLCIPFYNVVFRRVMKLLDMKLVGRNFYDPTSAMVLQQHRLQIW
+PGYAASIRRTDGGLFLLADVSHKVIRNDCVLDVMHAIYQQNKEHFQDECTKLLVGNIVIT
+RYNNRTYRIDDVDWNKTPKDSFTMSDGKEITFLEYYSKNYGITVKEEDQPLLIHRPSERQ
+DNHGMLLKGEILLLPELSFMTGIPEKMKKDFRAMKDLAQQINLSPKQHHSALECLLQRIA
+KNEAATNELMRWGLRLQKDVHKIEGRVLPMERINLKNTSFITSQELNWVKEVTRDPSILT
+IPMHFWALFYPKRAMDQARELVNMLEKIAGPIGMRMSPPAWVELKDDRIETYVRTIQSTL
+GAEGKIQMVVCIIMGPRDDLYGAIKKLCCVQSPVPSQVVNVRTIGQPTRLRSVAQKILLQ
+INCKLGGELWGVDIPLKQLMVIGMDVYHDPSRGMRSVVGFVASINLTLTKWYSRVVFQMP
+HQEIVDSLKLCLVGSLKKFYEVNHCLPEKIVVYRDGVSDGQLKTVANYEIPQLQKCFEAF
+ENYQPKMVVFVVQKKISTNLYLAAPQNFVTPTPGTVVDHTITSCEWVDFYLLAHHVRQGC
+GIPTHYVCVLNTANLSPDHMQRLTFKLCHMYWNWPGTIRVPAPCKYAHKLAFLSGHILHH
+EPAIQLCENLFFL
+>NP_067286.1_Mus_musculus_piwi-like1
+MTGRARARARGRARGQETVQHVGAAASQQPGYIPPRPQQSPTEGDLVGRGRQRGMVVGAT
+SKSQELQISAGFQELSLAERGGRRRDFHDLGVNTRQNLDHVKESKTGSSGIIVKLSTNHF
+RLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGRCHAFDGTILFLPKRLQHKVT
+EVFSQTRNGEHVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYYNPSDPI
+DIPNHRLVIWPGFTTSILQYENNIMLCTDVSHKVLRSETVLDFMFNLYQQTEEHKFQEQV
+SKELIGLIVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQ
+PVLVSQPKRRRGPGGTLPGPAMLIPELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQR
+EVGRLIDYIHKDDNVQRELRDWGLSFDSNLLSFSGRILQSEKIHQGGKTFDYNPQFADWS
+KETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGIQMKKAIMIEVDDRTE
+AYLRALQQKVTSDTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVARTLGKQQTVMA
+IATKIALQMNCKMGGELWRVDMPLKLAMIVGIDCYHDTTAGRRSIAGFVASINEGMTRWF
+SRCVFQDRGQELVDGLKVCLQAALRAWSGCNEYMPSRVIVYRDGVGDGQLKTLVNYEVPQ
+FLDCLKSVGRGYNPRLTVIVVKKRVNARFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFI
+VSQAVRSGSVSPTHYNVIYDSSGLKPDHIQRLTYKLCHVYYNWPGVIRVPAPCQYAHKLA
+FLVGQSIHREPNLSLSNRLYYL
+>NP_067283.1_Mus_musculus_piwi-like2
+MDPVRPLFRGPTPVHPSQCVRMPGCWPQAPRPLEPAWGRAGPAGRGLVFRKPEDSSPPLQ
+PVQKDSVGLVSMFRGMGLDTAFRPPSKREVPPLGRGVLGRGLSANMVRKDREEPRSSLPD
+PSVLAAGDSKLAEASVGWSRMLGRGSSEVSLLPLGRAASSIGRGMDKPPSAFGLTARDPP
+RLPQPPALSPTSLHSADPPPVLTMERKEKELLVKQGSKGTPQSLGLNLIKIQCHNEAVYQ
+YHVTFSPSVECKSMRFGMLKDHQSVTGNVTAFDGSILYLPVKLQQVVELKSQRKTDDAEI
+SIKIQLTKILEPCSDLCIPFYNVVFRRVMKLLDMKLVGRNFYDPTSAMVLQQHRLQIWPG
+YAASIRRTDGGLFLLADVSHKVIRNDSVLDVMHAIYQQNKEHFQDECSKLLVGSIVITRY
+NNRTYRIDDVDWNKTPKDSFVMSDGKEITFLEYYSKNYGITVKEDDQPLLIHRPSERQNN
+HGMLLKGEILLLPELSFMTGIPEKMKKDFRAMKDLTQQINLSPKQHHGALECLLQRISQN
+ETASNELTRWGLSLHKDVHKIEGRLLPMERINLRNTSFVTSEDLNWVKEVTRDASILTIP
+MHFWALFYPKRAMDQARELVNMLEKIAGPIGMRISPPAWVELKDDRIETYIRTIQSLLGV
+EGKIQMVVCIIMGTRDDLYGAIKKLCCVQSPVPSQVINVRTIGQPTRLRSVAQKILLQMN
+CKLGGELWGVDIPLKQLMVIGMDVYHDPSRGMRSVVGFVASINLTLTKWYSRVVFQMPHQ
+EIVDSLKLCLVGSLKKYYEVNHCLPEKIVVYRDGVSDGQLKTVANYEIPQLQKCFEAFDN
+YHPKMVVFVVQKKISTNLYLAAPDHFVTPSPGTVVDHTITSCEWVDFYLLAHHVRQGCGI
+PTHYICVLNTANLSPDHMQRLTFKLCHMYWNWPGTIRVPAPCKYAHKLAFLSGQILHHEP
+AIQLCGNLFFL
+>NP_808573.2_Mus_musculus_piwi-like4
+MRLRILGVHRALPTHARVAVCSNYLGKLEYSQTPSHSHTVSFAKEKTLLLRLTSPGKPLA
+PRNMSGRARVRARGITTGHSAREVGRSSRDLMVTSASPGDSEAGGGTSVISQPYELGVSS
+GDGGRTFMERRGKGRQDFEELGVCTREKLTHVKDCKTGSSGIPVRLVTNLFNLDLPQDWQ
+LYQYHVTYSPDLASRRLRIALLYNHSILSDKAKAFDGASLFLSEKLDQKVTELTSETQRG
+ETIKITLTLTSKLFPNSPVCIQFFNVIFRKILKNLSMYQIGRNFYKPSEPVEIPQYNKLL
+FNADVNYKVLRNETVLDFMTDLCLRTGMSCFTEMCHKQLVGLVVLTRYNNKTYRIDDIDW
+SVKPTQAFQKRDGSEVTYVDYYKQQYDITLSDLNQPVLVSLLKRKRNDNSEPQMVHLMPE
+LCFLTGLSSQATSDFRLMKAVAEETRLSPVGRQQQLARLVDDIQRTLPSSQEVLSHTSLP
+LWAPEPGGLSSAIPLSTVLPFAQQLLTALSLSPGIPLPHLKPPSFLFLCQPAFAADWSKD
+MRSCKVLSSQPLNRWLIVCCNRAEHLIEAFLSCLRRVGGSMGFNVGYPKIIKVDETPAAF
+LRAIQVHGDPDVQLVMCILPSNQKNYYDSIKKYLSSDCPVPSQCVLTRTLNKQGTMLSVA
+TKIAMQMTCKLGGELWSVEIPLKSLMVVGIDICRDALNKNVVVVGFVASINSRITRWFSR
+CVLQRTAADIADCLKVCMTGALNRWYRHNHDLPARIVVYRDGVGNGQLKAVLEYEVPQLL
+KSVTECGSDARYDFYLISQTANRGTVSPTHYNVIYDDNALKPDHMQRLTFKLCHLYYNWQ
+GLISVPAPCQYAHKLTFLVAQSVHKEPSLELANNLFYL
+>NP_001092322.1_Gallus_gallus_piwi-like1
+MTGRARARARGRPPGQEAAIPPVGAASAQKTLPSHPSEQRQSLQPCHPPPLTEEPGGRGR
+QRGPQDAPKTLGLQISAGFQELSLADRGGRRRDFHDLGVNTRQAIEHVRESKTGSSGAMI
+KLIANFFRLTSRPQWALYQYHVDYNPEMEARRLRSGLLFQHEDLIGKTHAFDGSILFLPK
+RLPNKVTEVYSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKMMNFQQIGRNY
+YNPKDPVSIPNHRLMVWPGFTSSILQYEESIMLCADVSHKILRSETVLDFMYSLYEQVEE
+RRFRDACAKELIGVIVLTKYNNRTYRVDDIDWDANPQCTFRRADGSEISYIDYYKRQYNQ
+DISDLNQPVLISQYRRKRGNVTVGPVVLIPELCYLTGLTEKMRNDFNMMKDLAVHTRLSP
+EQRQREIGKLVDCMKKDECVQKELRDWGLSFDSSLLSFTGRVVQAEKILQAGNVFDYNPQ
+FADWSRETRVAPLIHAKPLDNWLLIYTRRNYDAANMLLQNLFKVTPSMGIRMNKATMIEV
+DDRTEAYLRVLQQSITPDTNIVVCILSSTRKDKYDAIKKYLCTDCPIPSQCVVARTLSKP
+QTALAIVTKIALQMNCKMGGELWSVEIPLKQLMIVGIDCYHDTLSGKQSIAGFVASLNEK
+MTRWFSRCVVQSRGQEIVDGLKACLQTALREWFKWNKYLPSRIIVYRDGVGDGQLNTLVN
+YEVPQFLDCLKTVGKDYNPRLTVIVVKKRVSTRFFAQAGGGLKNPPPGTVVDIEVTRPEW
+YDFFIVSQAVRNGCVAPTHYNVVYDTSKLKPDHVQRLTYKLCHMYYNWSGVIRVPAPCQY
+AHKLAFLVGQSIHREPNLLLSDRLYYL
+>NP_899181.1_Danio_rerio_piwi-like1
+MTGRARARSRGRGRGQEPAAPGAQPPVSQEAAKPVVSTPSEGQLVGRGRQKPAPGAMSEE
+AMLQISAGFQQVKIGERGGRRRDFHDSGVHTRQLMEHVKESKTGVSGTAIELRANFMRLL
+SRPMWALYQYHVDYKPPMESRRLRSALLFQHEETLGKAHTFDGAILFLPNKLRNAETVLC
+SETRNGEKVEITVTLTNELPPSSPVCLQFYNILFRRILRILNMQQIGRHYYNPDDPFNIP
+QHRLTIWPGFMTTILQYESSIMLCSDVSHKVLRSETVLDFMYSLRQQCGDQRFPEACTKE
+LVGLIILTKYNNKTYRIDDIAWDHTPNNTFKKGDTEISFKNYFKSQYGLDITDGNQVLLV
+SHVKRLGPSGRPPPGPAMLVPEFCYLTGLTDKMRADFNIMKDLASHTRLSPEQREGRINR
+LISNINRNGDVQNELTTWGLSFENKLLSLNGRVLPSERIIQGGRAFEYNPWTADWSKEMR
+GLPLISCMSLDNWLMFYTRRNADVAQSLLQTLNKVSGPMGIRMQRAVMIEYEDRQESLLR
+ALQQNVARETQMVVVILPTNRKDKYDCVKKYLCVDCPTPSQCVVSRTISKPQALMTVATK
+IALQMNCKMGGELWSVEIPLRQLMIVGIDCYHDTAAGKRSIGAMVASLNQGMSRWFSKCV
+LQNRGQEIIDALKGSLQGALKAYLKYNNSLPSRIIVYRDGVGDGMLQSVVDYEVPQIMQS
+IKTMGQDYEPKLSVVVVKKRISSRFFARIDGKIANPPPGTVIDTEVTRPEWYDFFIVSQA
+VRFGCVAPTHYNVVFDNSGLKPDHMQRLTYKLCHMYYNWQGIVRVPAPCQYAHKLAFLVG
+QSIHKEPNMNLDDFLYYL
+>NP_001073668.2_Danio_rerio_piwi-like2
+MDPKRPTFPSPPGVIRAPWQQSTEDQSQLLDQPSLGRARGLIMPIDEPLPGRGRAFSVLG
+EMPVRFGRGITQSIAAEPLVGMARGVRLPMEEGGFGRGRGFLLPTPEPTVGIGRGAAIGP
+VPTLDIQKAEVEEKMPELQAEVAPTVAKVGSPGTGSSLVSMFRGLGIEPGKTWGRGAAPV
+GRGAAGDMGADLQPKPTIIGASLTPEREEVRSEESISFLGRGFTGFGRAAMPHMTVGRGP
+IGPLSPSPSVAAPFSLISASSSSEDAPVAPGTPPKVEVKIETVKEPLQKIGTKGSPIPIG
+SNYIPICCKNDAVFQYHVTFTPNVESLSMRFGMMKEHRPTTGEVVAFDGSILYLPKRLEE
+VVHLKAERKTDNQEIDIKIQLTKILPPSSDLCIPFYNVVLRRVMKILGLKLVGRNHYDPN
+AVVILGKHRLQVWPGYSTSIKHTDGGLYLVVDVSHKVLRNDSVLDVMNLIYQGSRESFQD
+ECTKEFVGSIVITRYNNRTYRIDDIEWSKSPKDTFTLADGSVTTFVDYYRKNYGITIKEL
+DQPLLIHRPKERSRPGGKVITGEILLLPELSFMTGIPEKMRKDFRAMKDLTMHINVGAQQ
+HTQSLKQLLHNINSNNEALSELGRWGLSISQEILVTQGRTLPSETICLHSASFVTSPAVD
+WSRELVRDPSISTVPLNCWAVFYPRRATDQAEELVTTFSRVAGPMGMRVERPIRVELRDD
+RTETFVKSIHSQLASEPRVQLVVCIMTGNRDDLYSAIKKLCCIQSPVPSQAINVRTISQP
+QKLRSVAQKILLQINCKLGGELWTVDVPLKYLMVIGVDVRHDTSKKSRSVMGFVASLNSM
+LTKWYSRVTFQMPNEEIINGFRVCLLAALQKYYEVNHAFPEKIVIYRDGVSDGQLKTVEH
+YEIPQILKCFETIPNYEPKLAFIVVQKRISTTLYSYGSDHFGTPSPGTVLDHTVTNRDWV
+DFYLMAHSIRQGCGLPTHYITVYNTANLTPDHLQRLTFKMCHLYWNWPGTIRVPAPCKYA
+HKLAFLSGQYLHSEPAIQLSEKLFFL
+>XP_002611940.1_Branchiostoma_floridae_piwi-A1
+MARTQKNKATSAHLGLLKARLAKLRRELIEPKGGGGGKAGEGFDVAKTGDARIGFVGFPW
+VGKSTLLSNLCACFRFPLRGPKITFIIVKKRINTRFFARAGPGLQNPPPGTIVDDEVTRP
+EWYDYFLVSQSVRQGTVTPCHYNVVWDTSGLKPDHIQRLTYKLCHLYYNWPGTIRVPAPC
+QYAHKLAFLVGQSIHTSPSENLAQTLFFLRLRQTYQTARNARNGVYAVRNGGLDAIDGVS
+GGVRDGPNAGSDGVWDGSDGVWNGLWDGSDGVWDGLDGVWDGPRRRLGRALGRLRRRLDR
+VRRHRRAIQTAALGSGMGSGTDQ
+>XP_002596179.1_Branchiostoma_floridae_piwi-B
+MMGLQDIPGLPAYGRGITQLGMQRQSTDTAVRPKERESPPVSSPPQAKQPSPSSPSVQQA
+SPQALAQPMAKLSLEEKKERNIPPPGTVGQPVRVACNYIPVKSNLTAICQYAVSFSPQID
+SRSMRYGMLYDHEDIIGDVKAFDGAILYLPKKLPQSVTEVQSTRKTDGALIKVRITLTNE
+LAPDDRQCLTVYNIIFKNVMRELELKQVGRNYYDPKHPIIIAQHKMEVWPGYITAIQAYD
+GGLMLNTDISHKVLRTETVLDMMQSIYQSSSGRGFQEACTKQLVGEVVLTRYNNKTYRID
+DISWDENPRSCFTFHTGEQVSFVDYYKKSYNINIMDDCQPLIISRPKKRAKDADVMLCLI
+PELCCMTGLTDNMRQDFRVMKDIAVHTRVTPMQRDLAMRKFIKNVDSNPKAKAAMAKWGL
+YLDHDLLRTEARQLPLEKIILKNRSFQSNVEADFGREVTREPVLVPVDLQCWMVLFCARD
+EHKANDYITMMKKVCPSLGIRVNTPALFRLENDRTETYLRIIRDNLKPQCKLSTVSGFLF
+SPLDTPDRSAWRVPDHFTQFTMNFVVQVQMVVCIFPTPRDDRYSAIKKLCCVDSPVPSQV
+INAKTIGSQQKLRSVTQKIALQINAKLGGELWALEIPLKNIMVVGIDVYHEIKKGVRSVA
+GFVASTNRELTRWYSRTCFQMPGQELMDGLKLCLTSALKKYHEVNHALPERIFIFRDGVG
+DGQLNTVAGMCFFV
+>XP_002590851.1_Branchiostoma_floridae_piwi-X
+MDDEEIWSATKTKGRGRGRGRGRGRGAAVVARAEDPDSVRRPVGRIPDGEETPPLIPSSP
+LRTNPSGDDPPNPALVEAVRRLSLQTTPADTAERGGGEHAGPQVVTNFIRFTPPENWLLH
+VYDVSFTPEVDNRKRRRSFIDQLFGPRAANYTWLFDGFKMLYVTTRHCLLDKLGYKQIRR
+YFYCQEDSVPVPQHKLSVMPGFDTAIMYHQGGFMLSVDLSYKILREQTAYDRMYAIYLKK
+GKGDYKRDMCREMLGKVVTTRYNNKSYTVDDIDFDRNPDTTFEKEGQKISFSEYYAQTYN
+RKISDVHQPLLVSRRRKRRPGMSENDEFIYLVPELCYMTNIEDTMRQDFRVMQDLATHTR
+PDPAKRAKMVLDLVKKLNRTRATRNEMEKWGMKVEPKLLNAPKVDLGRQTILIDGQPCDP
+GAKAEWSGHLRRTQVKGLPLLKTWFVVCPEAIMEAASNFIGFFKQDAPRMGFEVTNERIA
+RLPDDRVITYVSTLTQLVQEVKDLQMLVCIVPNDNKERYDAIKKLCYVDYPVPCQKQGQG
+EEVIPSIGKLFYAALKRWYNMNGQKLPGRIMVFRDGVGDSQMAMVKEMEISQLKMSADTF
+ISDLINSGETDVKMPKFTVIVCKKRISARFFMADKGGYLSNPTPGTTISASVTRMYEDES
+WSNFYLVSQSVRQGTVGPTHYVVIENESTSEGKTIPVQMLQKITYKLTHLYFNWPGTIRV
+PAPVQYAHKLAFLAGQHLHRDLRYDHQLADLLFFL
+>XP_002130490.1_Ciona_intestinalis_piwi-B
+MDKFNLPSVGRGRGLSVLKLLQEKSDSEAKSEECGSTTTLAAGDNTGVDSAVSKLSLTSS
+LGRGQTVGLIGRGQALSPPFQLQGAAGRGQMSFLSKGRGSALLQELGIGKSAEALKPCES
+LPVVLREKTPEVELKKQKTLTTQPQSIAQPSITSQDITKVDEVVKYHGQSGRRNDIRVNC
+VRVKCINLAVYQYHVSFEPVVDSRNMRFMLLNQHREVIGNTKAFDGTILYLPMKLELNEL
+RLKSKRVTDEADIVVLIRFTKAIDPASSQLIPFYNTVLKRCMRLLDMCPVGRNYYDPTSP
+KTIEKLQLILWPGYVTAIKKFEDGLMLNIDVSHKVLRQDTAKHVMVEAYKRSPNQYRDAC
+VKELVGAIVLTRYNNKNYRVDDIAWDMTPSSSFTNSKGDKLTFVEYYKVQYKIEITDLKQ
+PMLVHRPKKQTQRDFKRNEGEDYCICLVPELCYLTGLSDKLRSDFRAMREIRDNTSFDPT
+RRNACLEEFLKRVNMNTNAKNELLRWGLELDMKTCSTFSRSLPSEKIMVGRNQVFSCGPD
+ADFGREVTRSPVITPIPINNWLLVFVKRDSNKAENFFQKMMECTRKLGIDLSKPRFLQLN
+DDRTTSYKDAISQSLNPSTQLVVCIFPTSRDDRYNAIKKLCCVDMPVPSQVIISRTLPDD
+AKMGKFRSVTMKIALQINCKLGGELWTVDIPLKGLMVCGIDVYHDPLKRGKSVAAFIASS
+NRLMSTWFSKAIIQQPHQELIDSLKQCFVNALKNYYELNHALPERIVIFRDGVGDGQLNI
+VAEHEVVQLQSCFEMFSKVKGDKYNPMLTVVVVSKRINTKYFSLDSKGLSNPCPGSVLDH
+TVTRPNWPDYFLVSQHVRQGTVSPTHYIVVSGHEHLKPDHMQRLSYKLTHMYYNWPGTVR
+VPAPCQYAHKLAYLVGQSLGQHPAPQLCNKLFYL
+>XP_002120252.1_Ciona_intestinalis_piwi-X
+MEEKQSRARGRARGRGRVPPPEGGDGSRPPPPRTVGAEAKVAPRPGIHGEPASIAAPGRG
+VQRGAMRTKESSATGEVVRSMEAMSLQKREVPMIGRRSNYDPSMFDPRTRPDHIVSKQGV
+GGQPINLQSNFFPLSCTRQWCLYQYRVDYAPEVDHRGARKGMLKDHEGIIGNVFMFDGTM
+LFTTKKLPDKETVVYSKRRTDGSNVQLTIALTNELPPSSPISIQIYNILFRWVLDKIGMK
+QVGRNFYNPSMSFTVECQRVNFELWPGFITSILQYEKSVLLCAEVSHKLMRKDSVLDILR
+QMYGDCRQRGRDFKQEMEKFLVGQIVLTRYNNKTYRIDGIEWNLNVNMKFERKSGSVSYV
+DYYKEQYNIVIRDTNQPLLLSRPKQSEIRKGGLEVVHLVPELCTVTGLTDELRADFNTMK
+RLAVYTKQGPTKRKQALKSFIQRITTNTEVEKRFAEWGLRFEDRLLDLKGRVLDSETIMF
+GDNKQAQSRDASWDQEFRRQRLLKCIDLQEWAILFCSRDKRCAEDFVEKLLKVSRNMGFR
+VARPTPVELESDQMFQKRIRDVMGRNPKTQLICCMMPSSRKDRYEGIKKVCCVDMPVPSQ
+VVLSRTLSKPQRVMSIATKIAIQMNCKLGGEAWAVKIPLKECMIVGFDTYHDSSQKGRSV
+GGFVASINSTYTRWYSSVTFQHSGVELIDGLKRCMKGALQKFHQVNGKLPARIVIYRDGV
+GDGQLAVVKDHEIPQLLECLKIPQYKGFTPNVSFIVVKKRVNARFFAAGRDSELMNAPPG
+TIIDDTVTRPEWYDFFVVSQSVREGTVSPTHYNVVYDTSTLKPDHMQRLTYKLCHLYYNW
+PGTIRVPAPCLYAHKIAFLVGQSIHAPVSPTLADKLYFL
+>NP_001106470.1_Xenopus_tropicalis_piwi-B
+MDPTRPPFRGSPFHTPLGVRPPVLETKEEGPHGRAVLLPRGRALLGASAPSSDTTQRDPS
+DSRNVLPALFRGMGIETKPSGIPGRGGPVFGRGFLSTMSSGDGPDQPLSEPSIRPSLSTR
+VQQASDFSTERVALGRARFPIPPVSMEKPHVPTGRGLLFPSVLPTLTSDPVPKESPIATL
+QIEKEEKWEPLPKKGSKGSPCQLGLNLIKINFQNEAVYQYHVTFTPIVECRSMRFGMMKD
+HRSVTGPVTAFDGSILYLPVKLAQTVELESERRTDGQKIKITIQMTKILDPSSDLCLPFY
+NVVMRRVFKILDLKLVGRNFYDPASSTVLQQYRLQVWPGYAANIRKTDGGLFLLVDITHK
+IIRSDSVLDIMNILYQQSPENFQDEVTKQLVGSIVITRYNNRTYRIDDIEWNMSPKDSFS
+MSDGSKISFIDYYSKNYGITVKELDQPLLLHRPSERKAPKGKALDIVLLLPELAFMTGIP
+EKMRKDFRAMKDLTQQIHLSPKQHHISLGKLLKRIESSADAKNELQRWGLFLDTDIHMTT
+GRILPIEKINLRNNSFPAGEDLNWNREVTREACRSSVHLLYWAMIYPKRASAQAQELSSM
+LERIGGPIGIRVNHPNCVELRDDRVETYARSIKSLLEGEGKVQLLVCLISGTRDDLYGAI
+KKLCCVQNPVPSQVINTRTISQPQKLRSIAQKILLQINCKLGGELWGVDIPLKSVMVIGM
+DVYHDPSRGMRSVLGFVASINSCLTAWYSRVVFQLPNQEIMDSLKLCLVAALQKFFEVNH
+SLPEKIVVYRDGVSDGQLNTVENYEIPQLQTCFQTFDNYNPRMVVIVVQKRVSTNLYSTA
+TGQFLTPQPGTVIDHTVTNRKWIDFFLMSHHVRQGCGIPTHYICVMNTANLGPDHLQRLT
+FKLCHMYWNWPGTIRVPAPCKYAHKLAFLSGQFLHHEPSIKLCDKLFFL
+>NP_999765.1_Strongylocentrotus_purpuratus_piwi-A
+MDRRPGEQAPPPMQQAAPPQEASSGMPVPGRGRSRGGTTQPGPGAVPKQEPRGELTSQIA
+KLAIGASGEGRVGGAVQDRRRRRDEIELEPTTRPENFVKQAIAGDKIALIANGFKLKTKP
+DWQLYQYRVDFEPEILNPRARFALLKGHSALLGKGLTLDMDTMYSLFKLAEKVTNLSAER
+KDGSNVNICVTHVATLNPMAPNTLHLYNVLFRRCLKMINMEQVGRNYYDPTAAIDIKQHG
+LQLWPGFVTSILQYEYDVMLLSDISHKVLRTQTVWEVMNDLFNKARGRFKEEITKLMIGQ
+IVLTKYNNKTYRVDDIDFDTTPADTFETRSGPVSYVDYFKKSYERVIHDVNQPMLVSRPK
+KREEKKGVGPAYLPPELCFLTGLSDDMRADFNVMKDMGQHTRVGPQDRCRTLSGFIKKLS
+SNEEVKTYLDSWGMEFDKEQVKLTGRVLPPEKLFQRGKQFSYNPSNADWSRDTRGNALTD
+AKILNNWKIFYTRRDANRGQDFIKSLVRVANPMGMNVRGPEIVELPDDRTETYTRSLQAQ
+IAQDTQIVVVILPTNRKDRYDAIKKTCVVTHPCPSQVIVSRTLSKQQMLMSVATKIAMQM
+NCKMGGDLWRVEIPLSNLMIIGIDSYHDSLTKGRSVLGFVASMNKSQTSFFSSCAFQHAQ
+GEFGANLSTLMNNALKRYYQINEKFPERIIIFRDGVGDSQVNLVVDYELKQIKDTLDKVY
+PQGTVHKLAVVVVKKRINNRFFANLRGGLSNPPPGTVIDDVVTKPHLYDYFIISQSVRQG
+SVSPTSYNVVYDTTGLKPDHMQRLTYKLTHLYFNWPGTVRVPAPCMYAHKLAFLIGQSVH
+EVPNNRLADTLFYL
+>NP_001107667.1_Strongylocentrotus_purpuratus_piwi-B
+MAGFGRGGRGAALLKLLEEPQRRPGQNGDNTNGDKVEGKPASRPDTAPAPGAPKPGAPKP
+AFGRGLQMAAMQQQIKKEEPKPPGSQQSAQQQAAPTSFGRGFSGMPIGRGFTSQQQPTAQ
+KSPARQTPSPARQSPSPPGKSPSPTGKSPSPSMMTSSSAASSAYPSPAPTPTPSMGPGGD
+TRDRFANLDEKMGHLSLQGKEIHGTAGREVKAASNYIRIKCVNKAVWQYAVSFDPPIESK
+KIRLRMVFDHSDVIGKVRAFDGAVLFLPHKLPQKVTLFESVRLFDQETITIKIILGKEIN
+PQECTQIYNIIFRKVMKILQMKQVGRHFYNPTTPSIVPQHKLEIWPGYITAISQYEGGLM
+LHADVSHKVLCNESVLESMQAIYQRIPNNIRFREECVRQIVGTVVLTRYNNKTYRVDDID
+WDSNPQTTFKSRDEEISFIDYYKKSYSLEISDPGQPLLISRIKKKQLNNPGTPVEEEIRL
+IPELSSRTGLTDDMRADFRIMKDLAMHTRVTPQQRHQSMLKFIKNVYANEQAAEELSGWG
+LELQHDLLQLTGRQLPLENIKLGRSSFKASKEADWGRECTRQHVITAVPLRNWVVVFTRR
+DAPKAAEFIQMMKQVCPQMGIEIEHPSMVELQDDRTQSYTNMVKKSINPQLQLVIAIFPT
+SRDDRYSAFKKLCCIEAPVPSQVINGRTISQKQKLRSVTQKIALQINCKLGGELWALDVP
+LSKLMVIGIDVYHDPNRGKKSIGAFVASMNRDLTSWFSRVCIQTPHQELIGGLKLCFTSS
+LKKYHDINHALPEKIVIFRDGVGDGQLNVVATYEQEQLSQCFSMFGADYKPQLCIVVVQK
+RINTRIFSVAGGNYENPYPGMVIDHTITRPTWYDFFLVSQHVRQGTVTPTHYVVVHDSTQ
+LKPDHMQRLAYKLTHLYYNWPGTVRVPAPCQYAHKLAYLVGQNLHKEPSLELCDKLFFL
+>XP_001641994.1_Nematostella_vectensis_piwi-A
+MTGRARGRARGRGRSEAAQPGGADAARRPGEPQPATGRGRSRGPPAGAVGVGPPKPQPPP
+QQVAPPTQQMAAMSVEPRGAEPEERRERREYGSEPTTRRDGFNKEGSVGTKVGIVSNYFR
+LETRPQAAIYQYNVSFSPEVDFKKARFALIGEQRELLGNIRAFDGMVLFLPKKLPDQVTK
+IMAVRTRRETPDEPVEITITLTNELPADSPTCLHLFNIILKRILKYIDMKQVGRNYYYIK
+NAIAIPKHGLELWPGYTTSILKYEHSILLGADVSHKVLRKQTVLDFLYELYNKMQGRGNF
+HDEAAKKLVGEIVLTRYNNKTYRVDDIDWNKRPNSTFTTPKGEISFNDYYKKNYDFTITD
+QEQPLLFSKPKKRKGADDPVLLLPELCFLTGLSDDMRADFSVMKDLAVHTRLDPKARSKD
+LNKLISEINNNPDASGELSGWGLRFGRNLLDFDGRILPGEKIFQKNKGSNYDPKSADWSR
+EIRGAPLHSTVNLENWVIVHTNRDSGVATDFQQTLARVCGPMGINTTKPRMVPLNDDRTD
+SYLKALSNEIQADFPQIVVTIVPSNRKDRYDSIKKLCCLEKGVPSQVVVSRTLSKKQMLM
+SVCTKIGIQLNCKLGGEAWAVDIPLKNLMIVGIDTYHDSSQKGRSVGGFVASLNKPCTRQ
+REYYSRCTFQHSGQELVDGLKVCMTAALRQWQQINGVLPDKIIVFRDGVGDGQLRAVIEH
+EVPQILSTFKQFQDGYDPKFGFTVVKKRIQTRLFMREARDPDMRNLMNPPPGTVVDKEVT
+RSEWFDFFIVSQSVRQGTVSPTHYNVIHDTTGLRPDHWQQLSYKLTHLYYNWPGTVRVPA
+PCQYAHKLAFLVGQSLHKEPSLKLADKLYFL
+>XP_001620224.1_Nematostella_vectensis_piwi-B1
+RSLMVCGIDVYHDKARGGRSVGGLVCSMNRSLTRWYSDVCFQSPGQELIDGLKMLLIKGI
+RKWHDAIRKWHDVCYLTMFVSLSRPSGSGMMPSGSGMMYVIFNVCVLIKAIRKWHDVNNA
+LPERIIVYRDGVGDGQLKVVAGYEVQQFEECFASFGESYKPKLAVLVVQKRINTRIFSAE
+>XP_001626127.1_Nematostella_vectensis_piwi-B2
+IPLSCNYIRIHCPEQAVFQYCVSYSPEIDNRSERFHLLQQHPGFRGPQKAFDSTMLFLPR
+RLPQPVTQLQSTRRSDGSPVTVTITFTRVVPPDDAIFQVYNILFRRVMKILDMQQVGRYF
+YNPKTPAHIPQHNLVLWPGYITSLQHYEGGLMLLCDVHHRLLRTDSCLDYMLNMHSKVGD
+RFRDEVSKELIGSVVLTTYNNKTYRVDDIDWNKRPTSTFTFHNGEQMTFVEYYKKSYEIE
+IRDLDQPMIVNRPKKTEQKRGGVIEVILLIPELCKLTGLNDAMRKDFRVMKDIAAHTRVN
+PMQRQEAMKKFVMSINSTPEALEQLTAWNLRLDTSTLMTEGRQFPPEKIIYGNTTGSAGD
+QADWGRDATREKVISAVNLNNWMVFFTQRDSGKANDFVQTMNKCAPAMGIQVNQPKMNQL
+RDDRTETYLRSIRENLHPQVQVVVVIFPTSRDDRYAAVKKLCCVESPVPSQVIISKTISN
+PTKLRSVVQKIALQINVKLGGELWALDIPSRSLMVCGIDVYHDKARGGRSVGGLVCSMNR
+SLTRWYSDVCFQSPGQELIDGLKMLLIKGIRKWHDVNNALPERIIVYRDGVGDGQLKVVA
+GYEVQQFEECFASFGESYKPKLAVLVVQKRINTRIFSAEPRLGNPGPGSVLDHTVTRKDW
+NDFFLVSQHVRQGTVTPTHYVVVYDTSNWKPDIMQKLSYKLTHLYYNWPGTVRVPAPCQY
+AHKLAYQVGQSIHGQPSQELCDRLFFL
+>XP_002155913.1_Hydra_magnipapillata_piwi-A
+MTGRARGRSRGRGGGNEDAPQPPVGVQPEPYQAPAGRGRSRGSVPLQHAQPPQPAQPQQT
+AQPPQPVKVPPSDQRQQQMSSLPADMSKLQVRDEQPPRDERRRRGFGLEDSHVLKTREEG
+QLKVGTFGQQVEIVSNFFKVDFRSADLHLYNVVFDPDVQSSKFRHAMLHKIDDVIGSTRC
+FDGMIMYLPKKLLEPVTKLSVKTNKNEDISITITHRCAVPANSPSVVQLMNILFKKQLKI
+LNMQQIGRHYFNPDRKIDVQVEVERGIATQLQVWPGLQTSILQYEQSVMLCADVTHKVMR
+RDSVLDFLYNTHRSLSSQGKSNTFYEAAAKSLIGEIVLTRYNNKTYRIDDIDWNKHPTDK
+FTKADGSEISFQEYYEKTYERKVLDPMQPLLISKPKDKDKKRGTQGPILLLPEFCSIQGL
+SETMRSNFNVMKDLAQHTRISPEMRAKNLESFMNELQANPEAVQELTRWNMNYEKKLLRM
+TGRCFPAENMIQKDAKFTYKISDADWTKESRGKMLLSPVSISKWLLVFSQRDSNIAQDFK
+NTLQKVCGPMGMQVAEPELCRLNQDNAKAFFTALKENITNDLQIVVCIVPNNNKDRYDSI
+KRLCCVERPIPSQVVVSRTLSKQQMLMSVCTKIGIQLNCKMGGNVWAVDIPIQVMVVGYD
+VYHDSLTKGKSFGGFVASTNKSLTNYYSRITAHTSHQEICDQLKICMTGALKKYHEINNT
+LPDKIIVYRDGVGDGQLGMVHGHELPQLKEAFKDVGAGYNPKFAMIVVKKRITTRLFLGN
+NGQYSNPPPGTVVDTVVTRPEWYDFFLISQSVRQGTVSPTHYNVISDNTGLKPDHFQRLT
+YKLCHLYYNWPGTIRVPAPCQYAHKLAFLVGQSIHSEPNPVLADRLYYL
+>XP_002162153.1_Hydra_magnipapillata_piwi-B
+PPIESKNMRFGMLKEHTEVIGKAKAFDGSTLFLPHRLPQPQINLTSKRQTDNTAVQVTIT
+LVKVLAPSQCMQLYNVLLRRIMKILELQQVGRYYYDPKSPAMIPQHKLELWPGYITAIQA
+YEGGIMLLADVSHRLLRTDTCLNYMYDIIQKNQQDYQNEVTKKLVGTIVLTRYNNKTYRI
+DDIAWDKTPESTFTYHDGEEMSYVEYYKKSYNKELSDLGQPLLIHRPKEPKGGKPLEVIC
+LIPELCSMTGLTDDMRADFRVMKDIAQHTRITPNQRQMAMRKYIKNIYNNPTALAELENW
+GLHLEEDLLKIDINSWMVISTKRDQPKAFEFVQTMKQCCPQMGFKCGDPFFFALNDDRTE
+TYLRTIRENLNQKVQCVVCIFPTSRDDRYAAVKKLCCIESPVPSQMINARTISQANKLRS
+VTQKVALQINVKLGGELWALNIPMKNVMICGIDVHHDTSKGSRSVGGFVASTNSTFTRWY
+SRCVFQNIGQELIDGLKLCFVGALKKYHDENHSLPEKIFVFRDGVGDGQLEIVSNYEVKQ
+LQDCFPLLNDSYHPKMCVVVVQKRISQRLFAIQNGGLENPAPGSVLDHTVTRKDWFDFFL
+VSQHVRQGTVTPTHYVVVYDDTGLKPDHIQRLSYKLTHLYYNWPGTIRVPAPCQYAHKLA
+FLVGTSLHKDPALELSDRLFFL
+>Amphimedon_piwi-B
+MEDRPLPKTGRGAALAKVLEQSAGRTPGGVQSAAGRAPGGVQYGSPIAMAAPLPMGGRGQ
+SMTPPPHVITGTARGQGIQSLGRGHTLSTYGRGQPQTAPTNQNPAPPTNQSKAGPLAPDP
+IPVPKPIGRGMLLRKLYESQTKTQSLIPKQSPPSGAPPSDQLSQLQLQGAVSPPSKTPPT
+SSPRSPSSPASQATLKANQHSPPGPAHSPQTNLPVTSAGSPQFTLLSDGEIRQGISGQRI
+PLGANYLVVKSRSNTVFQYMVSFNPPVESKNMRYGMINEHKDLIGPTRAFDGSVLYLPLK
+ITDDIVTRKSIRSTDGTEITIDITLTNVLEYRECTQLFNIIIRRVLRAIDMQEVGRHYFD
+KNHPIKIPQHKMELWPGYVTSIHHFDAEHLLLLLDVSHKMLRMDTALDFLYELYSSCKDG
+FQEEATRQLVGSIVLTRYNNKTYRVDDIAWDKNPQSTFIDHNGRPMSFIEYYRNTYGRDI
+TDKEQPLLVHRPKKNRMHFKRGRGLPETDTAEEVEQVICLVPELCSMTGLTDKARSDFRV
+MKDLAAHTRITPAQREIAIKKFVRTVNESEKAKEELSSWGLSLHPNILETNGRLYKPETV
+LFRDGSVVAGLDADWSRQLVKEHVISAVPLTHWLLLVTKRDSGKAVDFIEMMKKVCPPMG
+IEVKEPRVIELQTDKTELYLRAIRENMSSSLQLVVAIFPTQRDDRYSSLKKLCCVECPIP
+SQVINARTISQQQKLRSVTQKVALQINVKLGGELWAVKTPLENAMVIGIDVYHDSTRGKR
+SVLGFVSSTNKFFTRWYSRVTIQGANQEIGDGLKICFQSSLRKYYEINHNLPDRIVIFRD
+GVGDGQVKTVVEFEIPQMKSCLAMFGESYKPKIGFVIVQKRIATRLFSHGPQGYENPCPG
+TVLDHTVTRKGWYDYFLVSQHVRQGTVTPTHYHVVLDNAGLKPDHMQKLTYKLTHMYYNW
+PGTIRVPAPCQYAHKLAFLVGQSLHREPSLEISDRLFFL
+>XP_003382553_Amphimedon_piwi-A1
+MSTRGGGGRGRGVGRGRSRGGGGMDTRRPGEGAQAAAPRGVRDQDGGQQQVGRGRGRAAA
+PIQPPQEQPPPTSTAAPVQQMQQMSLGEPRGGGRRIERRQDDDIHTKPEHITNKKGSFGN
+QTPIMSNYLVLRNRPGHAIYQYNVSYNPPVENKRMRLALLYHHEEALIGKVHSFDGMVLY
+LPHRLHNNPEEVISKTKEGDTIHITIKLTNELSANSPVCLQLFNILFRKILAKLEMKQIG
+RHYYNPKIPNIIREHSLEIWPGFITSIAQYESNVMLCADISHKILRTDTVLDLFHSLKST
+RDFHTEATKSIVGEIVLTRYNNRTYRVDDIDWEKTPASTFKTSTGEEISFITYYKKDEME
+ARRRGRDPATLGPLLLIPELCTMTGLTEEARANFKIMRDVATYTRQAPPQRIDTLNKFIN
+DVNTNPDVKSILGGWNLEFEKSLIKFQGRTLPTEKINQKGGSYTYQQAGADWSRDMRGKS
+MISSVNLKNYLIVCTNRDAGVAEEFIGTIKRIGPPMGIMIDEPQVEVLRDNRTDSFLRAV
+SGQLRDKSTQMVIVVLPQQKKDLYDAVKKLCCVDAPVPSQCIVSRTLSKKQTLMSVATKI
+VLQMNCKLGGELWALDIPVGVHCMVIGIDTYHDSASKGRSVAAFIASTNSTLTRYYSQTM
+FQQSGQELGDNLKACMTMALKKYHSINNTFPDRIVVYRDGVGDGQLHIVKEHEVVQMLES
+FSSTSGDSYKPKFAVVVVKKRINTRLFAPDQRGQPSNPLPGTVVDDQVTKPDWYDFFLVS
+QSVRQGTVSPTHFNVIHDTSGLTPDHMQRLTYKLTHLYYNWPGTVRVPAPCQYAHKLAFL
+VGQSIHKSPSTAIADRLYFL
+>Amphimedon_piwi-A2
+MRLALLYHHEEALIGKVHSFDGMVLYLPHRLHNNPEEVISKTKEGDTIHITIKLTNELSA
+NSPVCLQLFNILFRKILAKLEMKQIGRHYYNPKIPNIIREHSLEIWPGFITSIAQYESNV
+MLCADISHKILRTDTVLDLFHSLKSTRDFHTEATKSIVGEIVLTRYNNRTYRVDDIDWEK
+TPASTFKTSTGEEISFITYYKKDEMEARRRGRDPATLGPLLLIPELCTMTGLTEEARANF
+KIMRDVATYTRQAPPQRIDTLNKFINDVNTNPDVKSILGGWNLEFEKSLIKFQGRTLPTE
+KINQKGGSRF
+>C_9840002_Capitella_teleta_piwi-A
+MTGRARGRARGRGSRQPQQQQQAAPGAPRPAAAAAPSQQPPPPQQAPPPQQQAAAAAAPP
+CQPGPPTRQMASMSMGAAQGGRPRRGEYVAAPVTRPSHVMVKHGDYGNRVCMYTNTFAMS
+LGEGRAICQYHVNYTPPVESRGLRMRLVNEQKEMLGPVKIFDGMILYLGRKLDQVKTEYM
+GQTKEGDNIKVSIEFTGEVQPGTQSYMQILNIMMRRNLGALGMKLIGKNYFMPSRKVVEP
+QYGYEIYPGYTTAIHPFDGGVQLICDVAHKILRPHSVLDIMYDMHRNARGGNFHENCTKK
+LVGEIVMTTYNNKTYRIDDISWDVHPTNTFKQRDGTDITFNEYYKKQYDKKLEDMQQPML
+ISRPKKKDEREGAGDLLLVPELCRLTGISEEARADFMVMKNLSVFTRVSPQGRMERLIEF
+LTEMQKNEEVVKSMEGMGLAFANGLTRITGRNLGCERLVQGDGQQFGYVPKEADWSREMR
+GHKLKSCPPLQHWSILFSRQNEGQARDLHETLRRVSGAMGMRLGDPNMVKLPDGYTQTFI
+NALRQNVTDRTQLVVCVLPSNKKDLYDSIKKFCCCEKPVPSQCIIQRTLNKKQMLMSVCT
+KVAVQMNCKLGGEVWAVDIPPKGLMVIGIDTYHDSAQKGRSIGAFVASTNNTLTKYYSRC
+CFQTTGQELMSGLQICMRDALKHYMEQNRTLPERVFIYRDGVGDGQVDHVANSEVKQIME
+CFKTVGTDYAPKTAVIIVTKRINNRFFEPQRDGLGNPLPGTVVDTVVTRPEWYDFFLVSQ
+SVRQGTVSPTHYNVVHDSSGMSPNHLQRLTYKLCHLYYNWPGTIRVPAPCQYAHKLAFLV
+GQSLHRDPGITLSDKLFFL
+>C_350064_Capitella_teleta_piwi-B
+MCFHVRSAYNKDITDVNQPMLVHVPKKKDIQRQPRGKPLLERILLVPEFCFLTGLSDSMK
+ADFRVTKDLATHTRITPAQRHLSIRKFAENVNSHPEATKELAKWGITLASDIVTFQGRGI
+RPLDIVFGNKRTHTAGEEADWGRQLGRCPVITPVDIRNWILVFPNQDRAVANEFVQVMMQ
+EAPKMGIRVQPPVNGGMVLQNVRNESYISQLRSSIVPETQLVVCLMPRGRDDLYSAVKTL
+CCHEQPVPSQMIVSRTISDRKKQRSVVQKVILQINAKLGGELWSVAMPKMNLMVCGIDVY
+HDKLSGKSIAALVSSMNPQCTRWYSRTCEQMSNQELVDSLGPCFVAAIKKFAECNQGPPN
+RIVLFRDGVGDGQLAHVSQHEAAQLEKCFSNFSSEYKPKLSIVVVQKRINQRIFGIEGRN
+LKNPPPGTVVDHTITRFNWYDFFLVSQHVRQGTVSPTHYVVVHDDSGWDCDRMQRLSYML
+THLYYNWPGTVRVPAPCQYAHKLAYLQGQNLKKPFDQALANRLFYL
+>e_gw1.76.55.1_Lottia_gigantea_piwi-A
+MNSQNLKIVCTSRLLLQYKEVNNIVHTVNFLCSISGSAGKPIALLANFFPLEQQPTFVAL
+YQYQVDFNPSIDSRKLKAALLFTHDEMLGKVKAFDGGILYLPKKLQEKVCKRNFDDTKIQ
+ITITLTNELPQTSPQFLQVVNIIFRRLLAAIEMKEIGRHYFNPSLKVDIPRHKLSVMPGF
+ATSILQYENAILLGADIAHKIIRTDSVLDIMYSLYNDQRGGGSFYDKVFKALVGSIVLTR
+YNNKTYRVDDIDWEKRPTHKFKLHNGDEISYVDYYKKNYEITVNDLDQPLLVSKPKKKDL
+NRGMKDNIYLLPELCTLTGLSDDVRADFSVMKDVATHTRIAPEGRCKKLTDFIRVMNSNP
+KVQTEMNGWGLRFSQNLLELQGRVLPPEAISQGQVPLSYRPEDCDWSRDMRGKRLQSVVN
+LTDWIAIATKRDGGSAGDLVDTLIRVGGPMGMRINQPMVCELQNDRNETFLETLRKNLTE
+RIQMVLIVVPNNKKDRYDAIKKFCCVEHPVPSQVVVARTLSKKQMLMSVATKICIQMNCK
+LGGEVWTVEIPLTKLMVIGIDTYHDSSQKGKSVGGVIASLNTNLTRFYSTVTHQTQHQEL
+IDGLVASLNGALRKYHEVNGVLPEKIIVYRDGVGDGQLPTVFGHEVPQLLEALKKGGGSN
+YNPKLAVIVVKKRINARFFAKNNSNVSNPVPGTCVDNEVTKPEWYDFFLVSQSVRQGTVT
+PTHYNVIWDQTGLKPDHMQRLSYKLTHLYYNWPGTIRVPAPCQYAHKLAFLVGQSLHKDP
+SLDLADKLFFL
+>C_sca_80034_Lottia_gigantea_iwi-B
+MSANYIRVKCKNEGVYQYHVSYNPQIDSKFIRCRMINEHKAVIGETKAFDGALLFLPKKL
+PQENTILVSKRRSDGADITLTIKLIKVVPPEFCTQVYNILLRRVMSILELCQVGRYYYNP
+HTPSSVPQHKLEVWPGYITAIQEQEGGLMLLLDASHRVLRTETVLDVMQAVVRNNPKGFK
+DEITKLVLGNIVLTRYNNKTYKIDDLLWDKSPQSTFPASKTGQEISFVDYYKTNYNVTIT
+DVEQPLLLHRPRAKRMPGESEAKQEFICLVPELCYMTGLSDAMRSDFRLMKDIASHTRVT
+PAQRQMAMKKFLDAVRNNKEANSQFVNWGLELDCNTIDMQGRLLPVENIHFDRYVARDVQ
+NADWGRESSNNRCLVSVELKDWVVLATARDISKASGFIEMMSKVCPKMGIMIHSPKERKL
+VDDRTETFIRTLREVITPTTQMVVIICPTSRDDRYSAIKKLCCCEQPVASQVINAKTISQ
+PQKMRSVTTKIALQINCKLGGELWAVEIPMKNVMIIGIDVYHDVAKGKRSIAGFVASMNK
+ACTRYYSRCYFQGQNQEIIDGLKICLISALRKYHEVNHCLPDKIVIYRDGVGDGQLRAVA
+DYEVKQLHTCFAHFPNYNPNMALVIVQKRINTRLFLKGRNEMENPPPGSVMDHSITRRDW
+YDFFLVSQHVRQGTVSPTHYIVVHDGTGLTVDRMQRLTYKMTHLYYNWPGTVRVPAPCQY
+AHKLAYLVGQSIHKDFSEALSDRLFFL
+>XP_002413985.1_Ixodes_scapularis_piwi-B1
+MLPRSRCVGLPHVAIPGRRGVQVHLQNWVVMHTRRDGERTRGFTSMMSKVCPSMGIQVQP
+PIMRELPSDSTESYVRAIKEVLNQNVQVIVLIFPTSRDDRYSAVKRLCCVDMPVPSQVII
+SNTIGQQQKLRSVTQKVALQINCKLGGELWKVEIPMHNVMVIGIDVYHDITRGRQSVMGF
+VASMNQSLTRWFSKCAFQEPGKELVNCIKIAMLEAIVKYYEVNHKHPDRIFVFRDGVGDG
+QLSYVSDYEIEQLVQSFVNVSPDYKPSIAVVVVQKRINTRIFARLNGGRELDNPTPGTVV
+DHEVTRRDWCDFFLVSQKVRQGTVSPTHYIVVRNTTELSPDQMQRLAYKLTHLYYNWPGT
+IRVPAPCQQLFARNC
+>XP_002433561.1_Ixodes_scapularis_piwi-B2
+MSACSEEEFLGCGRGGRGALLLAALQKQTRRPGTGGSGDSSGDATVTSVVAPLPTDGTPV
+TVQVKFVKVTPPSQCVHLYNVLFKKVMHCLQLTQIGRNYFDHKGKILIPQHKLEVWPGYV
+QSVGEFEGGLLLNCDASFRVLRTVTARDVLYDVFNAYRQEYKTKALQAIVGNIVLTRYNN
+KTYRVDDISWDLKPTSTFTYHTGEEIAYMDYYKRIYNIDIQDTEQPLLLHRDKPRRDAPI
+ISG
+>XP_002411770.1_Ixodes_scapularis_piwi-X1
+PLLIAGDSGQQVKLLSNYFKLLTMPNWAIQQYHLEFAPNIESSRLRGGLLRDHRDRFGGS
+YIFDGMSDLKSPTRLEHKVTELYSQRRSDGSQIRITVKHVQELAPNNPELLRIFNTQMRR
+NLESMKFVQIRRQFFNAAGPKPISRHGLEIWEGLTTAVGQHDGGILMVVDTVHKVLRTEN
+VLHLLGSLQQSARGSYKDEAIKAVVGSIVMTRYNNKTYRVDDIDWSKNPQQTFETRNGPI
+TYMKYYKDVSLVLSLASCEGKDSAICWFCREQCRHVICAGLTDDIRSNFTIMKDLASEMK
+LEPSKRVSNLREFMQQMNRNEQVVKEMNQWGLKFTESLVEVDARQVQPEKVVHGNGLKSQ
+VNQMTADFSREMRDKTMFKAVRLDSWTVMCPRRDMPNAHDFVRDLLSVSRVIAGFALGCL
+NLVTLDDDRVSSYINALKNIPRETQLLMTIFPNNRKDRYDSLKKVACVDMGLHTQVMLGR
+TISNKKNLKSVATKVAIQMNCKLGGEAWALDIPLTKMMCVGYDTYHDSRQKGLSAGGFVA
+SLNRTLTRWYSRVSFHQTHQELGSALKTHMALSMKQYQEENDGAVPERLLFFRDGVSDGQ
+LLQVQEWEVGQIQSLLTEMFPGREPQLAFIVVTKRIAARFFGTGRGAFQNPLPGTVIDTN
+VTRPERYAVRFLPGLQSVRQGTVAPTHFNVIHDTTTLKPEHMQRLSYKLTHLYFNWPGTI
+RVPAPCQYAHKLAFLAGQSLHAEPHKNLSTTLFYL
+>XP_002399390.1_Ixodes_scapularis_piwi-X2
+MEPEDCGGGRARGRSRGRRKLLAGSLGDHESQRRPGGLAQQMRQLSLEPSGPFESGDSSP
+ETDVTGCGRGARRKPRNEVSMLATRPIHVTDKTGTTGRPIRLVANYFRLLSLPQCCVHQY
+HVDFVPSVESSRMRRALVGDHREQFGRCYVFDGMSDLKTPSRLEQEVTELWSRRRSDGEQ
+VCIRVKRVQELAPNNPDLLRLFNTQMRRNLEHLDFVQINRHYFDKRAVSAIPQHGLELWQ
+GLVTAIGQHETGVMMVTDTVHKVLRRDTVLDLLIQISATAPTGYREEAIRRVAGAIVMTP
+YNNKTYRVDDIDWDQNPQCSFDTKEGPKTYVQYYRAQYEKRIRDPNQPLLVCRPREKDLR
+VGRTHNIYLVPELCVLTGLTDEMRANVAVMRDLAQHTRVEPPRRVRNLLDFIGRVNGDSS
+VSHEMHQWGLQFDGQLVSIDARVMPPEWVIQGTQNYRYGANTADFSREMRDKRMHVAITL
+DSWIVICPKRDEQNCAEFVRSLMSVCPPMGLRVTEPRLLELEDDRAGSYVRALQQLSGLQ
+LALVILPNNRKDRYDMIKKHACVDLGLQTQVLLSRTIGNRKNVRSVATKVAIQLNCKLGG
+QAWCLEIPLASTMVIGYDTYHDSSQRGRSAGAFVASLNRTFTRWFSRASFHASHQELGNS
+LAIHLQDALRQYGCENGGAVPERILFFRDGVSDGQIPQVREWEINQIVASLDALFPGKDH
+KLAFVVVTKRISTRLFAVTSSGGYANPPPGTVVDSEVTRPERYDFFLVSQSVRQGTVAPT
+HYNVIYDTTGLKPDHMQRLSYKLTHLYFNWPGTIRVPAPCQYAHKLAFLAGQSLHTEHHV
+QLANTLFYL
+>mk4.000945.06.01_Schmidtea_Piwi-B
+MQTAAINQLLGQIVLTPHNNRNYRITDIDWAKNCLSEFDKGGEKISYRDYFKNTYGLQIR
+DLEQPMIVSKSNSRSGKNRGPKGSKEVDGGLVYLIPELCMLTGLTDDMIKDFRLMRELHE
+HCRVTPKKRHEALLEFVDNIYSCEEAKKLLGYWGITIEKDTVNINACKMNPEMIYFGNEA
+SVSAGEQAEFKQALAHNKVIGGIRIENWILISPKSLLTKANGLLQALMSKSPRVGVMFGK
+PKIVEMNNDRTEEYLKELKRNVAPGVQLVVTILSAVREDRYNAIKKFCYVDCPVPSQVVL
+AQTLKEGPKLNSVAVNIALQINAKLGGELWAVKIPIKKFMVVGLDVWHDTKGRSRSVGAV
+VGSTNALCTRWFSKSHLQEQDKEIMYVLQSCMLSLLKAYFEENNFLPETIFMYRDGVSDG
+QLGYVQKTEIEQFFKVFESFSADYKPNMVYNVVQKRINTRLYVSDPKNKGQINNPNPGTI
+VDHTVTRANLYDFFLVSQSVRQGTVTPTHYVVLCDNSKYTPHQVQLMAYKTCHIYYNWPG
+TVRVPAPCMYAHKLAYMVGQNLKAEPNILNDVDSCTEIEDLIEQAREAISNALLNTSSFD
+WKIGYHNSVKLCSQNTIKFDNCIILKRFCADDGFVNTFSFEE
+>mk4.000158.09.01_Schmidtea_Piwi-X1
+MILNIPGELCFFCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNRIKNNDVANGM
+CNKWQLKIDNRPLEIEGRELPGADVISGGCKFNEKMADDWKFGRVQFNIKRDRKHEIDVN
+FINDVEYELENMRISARVGRVNTCGPNEMEKCLNDSIKVSSECAKMSLVFVTDDRVYAKV
+KSFTMSTGLLTQCVTTRNATNRNDKRRKVVSSKAVLQIFAKFGYDPWTVVLKLKPTMIVG
+LDTYHNKSSKKSIQASVFSTNESFTQYLSFVNSPKGRQEFHETVNNNFGSTLEYFKKQFN
+ISPQRILVYMNGVGDNQLQFTKNFEVEAMKQLIENIYKSNGLPGPQIIYVIVKKRIGTKL
+FNRGNNPNPRTIVDKEIVKPNGFFLVSQRTTKGTATPTNYNVLEDTRLITKKGTKEPITP
+NELQRITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK
+>XP_002428948.1_Pediculus_humanus_Piwi-B
+MTRSKRQRVKISVQDFNIKCISTSILNDVQSKTKNTLLENEKPPVIRRGEGGQKIDVLTN
+YVLLKKDPEKNIYEYDVKFTPEVVNAAYRIRCYDGGNSFYLPEKLPEDAIVMKLKHPNDN
+SSLNLTVTYKKQKNYKECGKFFNILFNNCAKVLKLARLGKEHYEFRLSHQIPQHKLEIWP
+GYVTRVAEFEGGLLLCCDIRHRILRTESALEVFSNIAAIDPLNYKSVAFKELIGQCVLTR
+YNNNLYTIDDIDWDRTPLSTFKLSTGTDITFLDYYKRQYNIDIIDLEQPLLVSKTKIKNE
+KGEFKFMYLVPEICHMTGLTEKMKNDVKVMKEISAYTRITPYQRNYAFNRFLRNIKNNDD
+AKEMLLEWGLNIDVKPLEIEARILPKEFIILKDDKKIEAPSNGFWLSCIKNFGAFRTVRV
+NSWILFHTLKDKNLAYKFKEMILKVGPGLGMKILNPQMVALKNDKIESYIQGLRDNVNSE
+TQVVLCLCPTMRTDRYSAIKKFCCRETPILSQVVNTCTISRDHLLSSVAQNVTLQINNKL
+GGASWGVHIPLKNCMVCGIDIFHEKNNNSVGGFVSSFDNNFTKWFSKTCIHEPNQELMNG
+LESYLDVYMCLQENKVLPNRIFIFRDGVSHGMLRYVQDHEVLQFSEACKLLSKNYKPKIS
+FIVVAKRINIKYFEISENTSTVENPPIGSVVDHTVTLRNNYDFFLVSQHVKSGTAKPSHY
+IVLQDENNLQPHQMQRLTYKFCHLYFNWSGTIRVPAPCMYAHKLAFLVGQYLKGPVHSTL
+EDKLMLKLVLWLDYYLQLWKKYIIVTLQLINNSLSEKEPRKQYPFD
+>XP_002431988.1_Pediculus_humanus_piwi-P
+MSHVGGGDGPEEHGLGRGRGKRRKKTEAKQITIAPETNPCTVLEGKPGSSEPSCSSEKTA
+VSEGVPTKSDSSLATKIETLNLKTQDPGRSKYGQKRRSIPDIQSGSNYVTYTKPSKLLSK
+KGDFGTPIELVTNYFKLETVPNWVLYLYRVDFSVNEEREKILRSWLNQHRDRLKTAFIFD
+GSMLFTTQRLTATDEPLILTSIRDDGGDPVKITLRLVEPLQYGNPVYLQVFNILVRRCLM
+HLDLYLVNRNYYDPRASIHMPQHNIEIWPGYVTSIRQYEKDILMCAEITHKVMRTDTALK
+LLSDCCRESGNYKKIFHQAMIGAIVLTDYNNKTYRIDDVDFSLNPTCTFKYKNNENISYV
+DYYRQRYQLKIKDLRQPLLISRSNRKSLTSSEEEKQCILVPELCRMTGLDNRMLENRNLM
+KDLSDITRIPPHTRMERLKNFNRRLQNEKQVAEDLGRWQMKLSLQLMTVIGRELPPEEII
+TGGGKCTAGLEVDWTRSIRSVPMLKNGKFDTFVVICPYRLRRDTESFLSILKKTSSGMNF
+HIPLPNIFETRSDSPAEMVEKVDYVLAMCRPDLILFSFMSNRADRYSAVKKKCYVDRGIP
+SQVILARNLTSKGVMSIATKVAIQINSKIGGAPWTVNIPFDNFMVVGYDVCHDTVRKSKS
+VGALVASLNKAMNAWFSCVNFHENGEELSDTIALDICKALRKYKEINKSLPARIFVYRDG
+VGEGQINYVYKHEVEMLKKVLTDIYNGPNWKLSFIIVTKRIKTRFFNKERNPRPGTVVDD
+VVTLPERYDFYLVSQSVRQGTVSPTSYNIISDNVGWTPNHFQRFTYKLTHLYYNCSTSVG
+VPAPCQYAHKLAFLKEKKKKVQ
+>NP_001036627.2_Drosophila_melanogaster_piwi-B
+MSGRGNLLSLFNKNAGNMGKSISSKDHEIDSGLDFNNSESSGERLLSSHNIETDLITTLQ
+HVNISVGRGRARLIDTLKTDDHTSNQFITSESKENITKKTKGPESEAIASENGLFFPDLI
+YGSKGSSVNIYCNYLKLTTDESKGVFNYEVRFFPPIDSVHLRIKYLNDHKDKLGGTKTFD
+GNTLYLPILLPNKMTVFISKAEDVELQIRILYKKKEEMRNCTQLYNILFDRVMKVLNYVK
+FDRKQFDPSRPKIIPLAKLEVWPGYVTAVDEYKGGLMLCCDVSHRILCQKTVLEMLVDLY
+QQNVEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQY
+HNINIKDVNQPLIYSIKKSRGIPAERENLQFCLIPELCYLTGLRDEVRSDNKLMREIATF
+TRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYFSKISV
+SAGRSAEFSKHAVTNEMLKVVHLSKWIIIHLRNYRQAATSLLDNMKQACESLGMNISNPT
+MISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDRYAAIKKICCSEIPIPSQVINAK
+TLQNDLKIRSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVA
+SINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQL
+YTCLNYEIPQFEMVCGNRIKISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNM
+YDFFLVSQLVRQGTVTPTHYVVLRDDCNYGPDIIQKLSYKLCFLYYNWAGTVRIPACCMY
+AHKLAYLIGQSIQRDVAEALSEKLFYL
+>NP_476875.1_Drosophila_melanogaster_piwi-P1
+MADDQGRGRRRPLNEDDSSTSRGSGDGPRVKVFRGSSSGDPRADPRIEASRERRALEEAP
+RREGGPTERKPWGDQYDYLNTRPAELVSKKGTDGVPVMLQTNFFRLKTKPEWRIVHYHVE
+FEPSIENPRVRMGVLSNHANLLGSGYLFDGLQLFTTRKFEQEITVLSGKSKLDIEYKISI
+KFVGFISCAEPRFLQVLNLILRRSMKGLNLELVGRNLFDPRAKIEIREFKMELWPGYETS
+IRQHEKDILLGTEITHKVMRTETIYDIMRRCSHNPARHQDEVRVNVLDLIVLTDYNNRTY
+RINDVDFGQTPKSTFSCKGRDISFVEYYLTKYNIRIRDHNQPLLISKNRDKALKTNASEL
+VVLIPELCRVTGLNAEMRSNFQLMRAMSSYTRMNPKQRTDRLRAFNHRLQNTPESVKVLR
+DWNMELDKNVTEVQGRIIGQQNIVFHNGKVPAGENADWQRHFRDQRMLTTPSDGLDRWAV
+IAPQRNSHELRTLLDSLYRAASGMGLRIRSPQEFIIYDDRTGTYVRAMDDCVRSDPKLIL
+CLVPNDNAERYSSIKKRGYVDRAVPTQVVTLKTTKNRSLMSIATKIAIQLNCKLGYTPWM
+IELPLSGLMTIGFDIAKSTRDRKRAYGALIASMDLQQNSTYFSTVTECSAFDVLANTLWP
+MIAKALRQYQHEHRKLPSRIVFYRDGVSSGSLKQLFEFEVKDIIEKLKTEYARVQLSPPQ
+LAYIVVTRSMNTRFFLNGQNPPPGTIVDDVITLPERYDFYLVSQQVRQGTVSPTSYNVLY
+SSMGLSPEKMQKLTYKMCHLYYNWSGTTRVPAVCQYAKKLATLVGTNLHSIPQNALEKKF
+YYL
+>XP_001949977.1_Acyrthosiphon_pisum_piwi-B
+MSGRGFLKSRLAKAASKEPEEPPTPQEHPKSEEPPKLAALPIPYTEVPVAAISSQTLVAG
+NQQVARGRRAMLANIAQGPVSQKLCDTIQSAFSNIDLGDLKNIVRPNTSPEHKKADVVSE
+LLTPPKQPQTTIVDIPAEKEEKTPVICRVLKKSEKDAYHMAQLSSNYIRIKLEEDKGIYE
+YRVDFNPPVDVKSARFFLLNEHRDLFPVKTFDGTLLYIPKMLPQNVTKLVGKLRDESEVT
+LTITFKRKNSLRECIHFYNVFLRTIMKILGLVEFGRSFYDENKRILIPEFKLEVWPGYIT
+TIDEFENGLYMCAEVSHRVLRVQTVLQIMTDIMMNAKTNNTDSKQEIMAALCGSTVITHY
+NRKTYRVDDVDFTMNPLSTFEQNGVEVTYKDYYKKMYDVEIKNLQQPMIITKAKKKDINR
+KNPDDLGICCLVPELCNSTGLTDAMKSDFKLMKVLQNHTLVTPEVRQNAIVEFVNRINAH
+EVASKKFKDWGLMMRPIPVKMEGPVYKRETILLGSNIRKQVGVNMDWGMDVAKNAMFVAV
+NMLNWAIVYNPRDETTAKSFCKQLVSCGRPLGMEINPPKPIKVQGTNPEVFVSTINSTLK
+NNSDIQIVVIIFPNQREDRYNAVKRICCSEIGIPSQVIVSRTLSKPERLQSITQKIALQI
+NCKLGGACWAIDIPLKNTMIVGIDVYHEKGKQMSSVVGFVASMDKTFTEWYSVAAMQRST
+HQELMKSMQDAFHKVVTQFKLKNGLLPEKIIIYRDGVSDGDLKQVEEIELSDLIESFKSY
+PGQYNPMVSLIIVQKRINTRVFQYVNEKYSNPSSGTVIDNTVTRRNYFDFFLVSQHVRQG
+TVNPTHYIVLKNGCNLSVENIQRLSYKLCHLYYNWCGTVKVPAPVQYAHKLAYLIGQNVR
+QKPSDKLCNSLFFL
+>XP_001942742.1_Acyrthosiphon_pisum_Piwi-P1
+MEPIRPSRGKARGRPQFPTIQPGAGLSNLPPQGIRGPRPTIPSQPITSSQPITSSQPIAS
+SQPIASSQPLQTPVTGTMPRPPRPMPPRPTGAPQQRAPRPLGPRPGMSSDNLPRPGMSSD
+NLPRPGVSGDNVPRPGVSGDNAALKQDPMVQQITEGLKTLGAGDALVPLGRGAVRGRRQI
+DVEHFRTPRPQSSLGDIGKQGTSGQPVKLLANYFPITSYTNWCLYQYRVDFNPEEDRISS
+KRGLLAQHRELLGGYLFDGTMLFSGTRFDPPTFELTSTRRQDDQIVIISVKFTNIIETGD
+YANIQVFNLLLRNCLRHLKLTLIGRNFYDPDAKIDMAQHKLQLWPGYETTIGRYEDNILL
+CAEISTKVMRQETVLDFLNQCAADRNRNKDWMINFKSGVVGTTVMTKYNNETYRIDDIDE
+NSDPNSEFSKKDGSKMTYLQYYKEKWNITIRGGRQPMLISKNKKSVRRFGAEDTLVYLVP
+ELCIMTGITDAMRNNFTLMKDMAIHTRVNPKERMERLTNFANRLLSTPESVTELKRWNLT
+LSNKLVELTGRTLQPEPIQSRSKGYNGGEEADWTKHLRALPMFTSATVKNWTILAPKDCC
+REVEAFAQSLSKAAQGMTFVLPRPVIFPMVDGRSNTFLNDLEKVINESNPSLILCVIPSA
+RGDIYSMIKRKLCIDRAVPSQVVLLKNVQKNNLSVCTKIAIQINCKLGGAPWLVTIPKKG
+MMIVGFDVCHDSQRKNISFGALVSTMNDAHTSYFSCVEPHESGEELSVHFATGISKALAK
+YRAKNGALPTSIIVYRDGVGEGQISHVHKTEVRLLQTACEQFYGASSVPLAFVIVTKRIS
+ARFFAPSNRGPENPRPGTIIDSVVTDPTKYDFFLVSQHVRQGTVTPTHYQVIEDTLRLPP
+DIMQRLTFKLTHMYYNWSGTVRVPAPCQLAHKLAFLTGQSLRRSPNIGLDELLYFL
+>C_200184_Daphnia_pulex_piwi-B
+MHPATNEPVEVKLTLRQKRRAADSIHFYNVLIRKIARILGMVQMNRNYFNPSSPIIMNVE
+KLEVWPGYVTAINEFEDGLMLCCDVSFRVLRTTTVRDELKKGGYFHQTAQDVLIGLSVLT
+RYNNKMYRIDEILFDKNPLSIFDCQGEPMSYVDYYKKQYNIDIQDKGQPMLLNRLKKKMQ
+GKEDETVLVCLVPELCFLTGLDDRLRSNFTIMRSLATHTKVAPMARVKALTDYIESVNNN
+ERAASVLSEWGLSLAPMPLSLEGRVIEPEKIFLSKSNFTTNPQCDWSRNLGNDILVAVKI
+ETWILVYTDRNLNNANDFSKTLMEVGSKMGIRIKPPKMVGLPNDRTDTYVNRIRDEINSS
+LQLVVAIFPTSRDDRYAAVKTLCTAQYAIPSQMMNSKTISNPSKLRSVVQKIALQINCKM
+GGELWAVSIPTKTLMVCGVDVYHDPTKRGQSVVGFVASVNPGLTRWFSRAKYQGPGVELV
+DTLKICFLESLKKYYELNQDYPKQIVLFRDGVGDGQLQFAAAHEAAQFLSAFQALSPPFE
+PKFTMVVVQKRINTRLFHNSRGAINNPPPGTVVDHTVTRRDWWDFFLVSQFVTQGTVSPT
+HFIVVHDGGMKPDNLQKLAYKMTHMYYNWPGTIRVPAPCQYAHKLAYLVGESIRKEPQLE
+LSNRLYFL
+>C_30645_Daphnia_pulex_piwi-X1
+MEVHVTSNYFELMKRPDMHLLQYRVDFVPDVDHIGARKALIRVHEAKLGKYLFDGTLLYN
+ITRLPQPLELLSKRISDNSDVAIHLRLVGEIHKEDAAYTTVMNIILRRCLGMLNLTLWKR
+DYYDPAAATEIPQHFLNIWPGYVTTIRHHEEGFLLGVEIIHRVLRRDSALDVMNKIRQAS
+DQFEAMCSAELVGKVVMTHYNKRTYRIDDIDFTKNANSTFHLRKEDRDISYLEYYKTRYN
+IEVRQPSQPLLVSRPTRRDANRGDDQPIFLIPELCGMTGLTDDQKKNFTLMKDVGNITRV
+MPDKRVESLMRFRKRLADNPEIQRELNSWGLNFAGDIVRINARVIPPQTIQQGGNSFTTP
+DGDWSRNIQRSKMCITVELRDWALFTPSSMTQEVKPFIQMVQNVGRGQGFDIPDPVVSQM
+QMDRTSNYVDAIRNECRQKGFSLIFCVLRSARADTYSSIKKLTCAEFGIPSQVITGRNLK
+GQTGKLMSIATKVMIQIASKLGAEPWRVLVPNTKWMVIGYDTYHDARQRKAVGAFVASTN
+PTFSKYYSSVKIHENNEEISPSFKDHLFGALKAYFIVNDKTLPTSIIVYRDGVGAGDIPR
+LKDTEIAALKVKLIAQYNPSIAFIVVSKRINTRFFQMSGRSPMNPVCGTVVDSKVTLQER
+YDFFLVSQKVTQGTVSPTSYNIIEDDTGINPDIHQRLAYALTHLYYNWPGTLRIPAPIQY
+AHKLAYLVGESIMQQPHDNLSRLPYYL
+>NP_500994.1_Caenorhabditis_elegans_piwi-X1
+MIQNDYSIYQYHVEFEPTVDSKATRENMLRQPSVTVEIGKHFVFDGMILYLKEEWDQNQM
+IEVQHPNDNSLICIRFKKTNRFLVDDPQTINIFNTIIRRSFDAMKLTQIGRNYFDWDNSR
+ALRKELRSCQNNRQRVQEKMNEVYGGSTIITRYNNKLHRFTRLDNEITPLSKFQKDGEQI
+ILKEYFKNQYDIDITDDEQFIIISEGKPKQPGEPPQVNYIVPELCFPTGLTDEMRKDFKM
+MKEIAKHTRMSPQQRLDETRKLITKLSQNQTMMECFQYWGISLGQDLANVQARVLKSEPL
+QGKRQYEGKQAEWARGVKECGIYRGSNMTNWIVIGPGSGNSGLLAQKFIAEARNLGRTLQ
+VQLGEPMCVKINGISPNDYLEGLKAAIKSVDGEEIHMLVVMLADDNKTRYDSLKKYLCVE
+CPIPNQCVNLRTLAGKSKDGGENKNLGSIVLKIVLQMICKTGGALWKVNIPLKSTMIVGY
+DLYHDSTLKGKTVGACVSTTSNDFTQFYSQTRPHENPTQLGNNLTHFVRKSLKQYYDNND
+KTLPSRLILYRDGAGDGQIPYIKNTEVKLVRDACDAVTDKAAELSNKVQEKIKLAFIIVT
+KRVNMRILKQGSSSKSAINPQPGTVVDTTVTRPERMDFYLVPQFVNQGTVTPVSYNIIHD
+DTGLGPDKHQQLAFKLCHLYYNWQGTVRVPAPCQYAHKLAFLTAQSLHDDANGYLRDKLF
+FL
+>NP_492121.1_Caenorhabditis_elegans_piwi-X2
+MASGSGRGRGRGSGSNNSGGKDQKYLGTIQPDLFIRQQGQSKTGSSGQPQKCFANFIPIE
+MTQSDYSIYQYHVEFEPTVDSKANREKMLRDNNVTDEIGHHFVFDGMILYLKEEWEQNQM
+IEVQHPIDRSLICIRFKQTNRFLVDDPQTINIFNTIIRRSFDALQLTQLGRNYFNWGDSR
+AVPDYNMSILPGYETAIRMYEENFMLCVENRFKMVREESMYILFHKELRSCQNNPQRVQE
+KMNEMYGGTTIITRYNNKLHRYTRLDYSISPLSEFVKDGQSITLKEYFKNQYGIEITVDD
+QPIIISEGKPKQPGEPPQVSYIVPELCFPTGLTDEMRKDFKMMKEIAKHTRMSPQQRLVE
+SRKLIVDLSKNEKVMECFKYWGISLGQDLANVQARVLKSEPLQGKKTYEGKQAEWARGVK
+ECGIYRGSNMTNWIVIGPGSGNSGLLSQKFIEEARRLGKILQVQLGEPMCVPIRGISPND
+YLEGVKGAIKQVDGEDIHMLVVMLADDNKTRYDSLKKFLCVECPIPNQCVNLRTLAGKSK
+DGGENKNLGSIVLKIVLQMICKTGGALWKVNIPLKNTMIVGYDLYHDSTLKGKTVGACVS
+TTSNDFTQFYSQTRPHENPTQLGNNLTHFVRKALKQYYDSNDQTLPSRLILYRDGAGDGQ
+IPYIKNTEVKLVRDACDAVTDKAAELSNKVQEKIKLAFIIVTKRVNMRILKQGSSLDNAI
+NPQPGTVVDTTVTRPERMDFYLVPQFVNQGTVTPVSYNIIHDDTDLGPDKHQQLAFKLCH
+LYYNWQGTVRVPAPCQYAHKLAFLTAQSLHDDANGCLRDKLFFL
+>XP_002154701.1_Hydra_magnipapillata_ago
+LKIEITYMGKQKRKYKVNGVTEKSVTEQMFSIEENGKKRNISVAEYFRKEKKVEIKFPAL
+PCLHVGDEKKTVYIPMEVCRVVPGQRCLKRLNENATAKMIKIAAKRPNLRQATIDNIMKN
+ANFPQDKYLNSFGIQIAHSMVELNGRILSTPGIKYGAWNMKGRRLYKGAIIKKWGLIVYD
+IGEPLQNEVLIKFQTELIKLAKEIGIQIDNPVYQARAPANELPESVISKAFKKDKDIELL
+VFILPGKTPFYGDIKRLCETENGYTGFCDPDVQNLIKKKGVCTQCIQSKNVFYLNPMNLA
+QLCLKINSKMGGTNNVIVFIFRPLNVFKEPVIFLGADVTHPGVGDKSSPSIAAIVGSIDE
+VPSRYSACVRIQGHRVEVIEDLENVTVELLKQFYRHMKVKPRKIIMFRDGVSEGQFQQVL
+FHEMSAIQKACIKLEKGYEPGITFVVVQKRHKAKFFPVNKNDEDRSGNVSAGTTIDTVVC
+HPTEFDYYQYSHSGIQGTSRPAHYHVLWDDNNFSADELQALSFMLCHLYVRCTRSVSIPA
+PAYYAHHVAFRSRSHLQNEEGSISSSESDTGKNSVEFVKANYKDVVKLHPNMETKMYFV
+>XP_001638494.1_Nematostella_vectensis_ago-1
+MASNNPVNRVGGNFNPPKRPNHGSTGRTIALRANFFPVQLPRGNIHHYDLSICPDKCPRR
+VNRDVVEVMVLNYHKVFGGMKPVFDGRKNLYTRDPLPIGKTPTEFEVVLPTDNSQDKKFK
+VTLKWVSQVSLYALEKALEGTCNQIPFETIQALDVVLRHLPSMKYTPVGRSFFSPPDGYD
+FPLERGREVWFGFHQSIRPSQWKMLLNIDVSATAFYKCQSVVEFMCEVLRIRKDDLEKHA
+PLNDADRLRFTREIKGLKVEITHCGPMKRKYRVINVTKQPAQALQFPLTLESGQTAQITV
+ARYFQDKHKQRLRYPHLPCLQVGQEQRHTYLPLEVCNIVPGQRCVKKLTDTQTSKMIRAT
+ARSAPDREREIRGLVKKANFDEDAYVKDFSISIGKNMVELQGRVLPPPKLVYGGKVRIEK
+IIHSFSGVWDMRGRQLFHGIEIRTWAIACFVKQQMCTEDSLRRFSNQLMKISVEQGMPIS
+CPPVFFRYARNPDEVERMFRRLKEAHPDLQMILVVLPGKTPVYAEVKRVGDTMLGVITQC
+IQGKNVTKPSPQTLSNLCLKINAKLGGVNNILAPEIRPPVFREPVIFLGADVTHPAAGDD
+KRPSVAAVVGSMDAHPSRYYASVRVQTHRQEIIAELAAMVRELLVQFYRSTRHKPQRIVF
+YRDGVSEGQFRQVLVHELKAIREACIKLEVGYQPGISFIVVQKRHHTRLFCQRDQDKCGK
+SGNVPPGTTVDRGITHPTEFDFYLCSHAGIQGTSRPSHYHVLWDDNNFSADELQALTYQL
+CHTYVRCTRAVSIPAPAYYAHLVAFRARYHMMDRDKEAGNDNSSVASGEDCRGPQLLANA
+VQVHPKVLQGMYFA
+>XP_001630646.1_Nematostella_vectensis_ago-2
+QENMELPKRPGYGREGRKIKLRANFFQVTLPNVDFLYHYDLEISPEKAPVSVCRDVVDAA
+IKHGEFKGVFNGCKPAFDGRRNLYCREPLPLKSEEASLKVTLPGTDGGKERKFTLKIKEA
+GLVSIKELDQFLNGEFRGKVPQDAIQGMDIVLRQMPSMKFTAVGRCFFPPPNGHCHDLGG
+GCELWTGFYQSVRPSQWKTMLLNIDVSSKGFQKSMPVIDFMLEILRQDRNRVLDTRWVMD
+ERDKKKLTTEIKGLRVETTHIKRKFTVMGLSHPAFNNRFRLEDNTETTVEAYFRNKYNIS
+LRYPHLPCLLVGQKKNSVPMEVCNMIPTQRKRLTDEQTAAMIRKTAKPANERQRDINQWV
+DELATASDQYLKNEYGMRINKQMVAIEGRVLPAPELTLGGNPQGSALTPSDGAWDMRGKS
+FFEARTVEVWALVCFSHPKWCPKEKLEGFARQMGNVCRSEGMRMNPVPCRAEYASRVQEV
+EGIFGKLLHDFNSLQLIVVALPDRGNKDVYNEVKRVGDTVLGIPTQCVQMKQFTMAKPQV
+CSNIAMKINGKLGGTNHVIADSLKATITDDKGNGIFNSPVIIFGADVTHPAPGDNGIPSI
+AAVVASLNRNASRYCARVRPQTHMKCKQAQEIIVDLADMDVHIYIRLWRKLESHDTQTMF
+RRFQVLLEEVRAVQQACAMLEKDYQPLITFVVVQKRHHARLFAEEGRDARGKSRNVPAGT
+TVDTVICHPFEFDFYLCSHAGIQ
+>XP_002118712.1_Trichoplax_adhaerens_ago
+MAATAFTKAALPQRNGFGSKGKRIAVYANHYPISFQAENSIIQYDMQTNPEVKIKSDLRD
+FISILQSSYSQLFRGVVTAFDGVRNIYANKRLNGISSDGKTFTIDKEMRPGAIKSFKIQI
+KEVQLIQLTDLNRALRGETDVPYQAIQAVDVVLRCTLAKKFTMVYRSFYPEPADDDWRSL
+GCGHESWRGYYQSARSTQTGLSLNIDTSHTAFYEAVLVHNFIARYFNQDEIRSLRDFQRK
+TMASELKNVKVTALHGDKKRKYRITDISNNKPNQIQFDHNGKRVSVTDYFKTTYGYTIRY
+PDLPCLKMNNKEIHLPMEVCEIIPGQYYKKKINERETASMVRFAAIPADQRRGKIDTFVN
+RTAQYSTDPVSKGFNIQVDPHMKKVDARVLSPVKVIYRSGEMLPRDGSWNLQNAQFISSK
+QVHSWGCVWFRDRMLNPRKVEVLISKLKKSTADCGIEGINEKNLCMQIKNIDKANHQFLA
+NLALKINAKLGGTNNTINQSELLKKPTIIFGADVTHPGIGDQTSPSVAAIVGSANIDLSH
+YFHAIRIQEHRKEIIQDLQSVVKTMMLSFYRKLHRKPERIIFYRDGVSEGQFNDVIREEL
+TAIEKACRSIEEGYRPAITFLVVQKRHHTRFFPSQNKDSVGKARNVPPGLVVDRGVCHPS
+QFDFYLCSHFGIQGTSRPTHYHVLLDENKLSADSLQEFTYQLCHVYCRCTRSVSIPAPVY
+YSHHLAFRARSYMAQLGGEMRPQEMNRKIEQVLSKNIGGAVFFA
+>AY493987.1_Podocoryne_carnea_Cniwi
+MTGRARGRARGRARGGQDAPKPGGGAAPAAPGGAPGGGRGRSRGAPPPQAQTAPAQAAAP
+KPAAQAPTEQMSRMAVGEERPAAQQQERRRRRLGEEANILQLKGKDQVTEGTAGARCNIV
+SNFFKVAKLPNFTGLHQYNVSFDPDIQSGKLKSAMLHNLDDVLGTVRCFDGMTMFLPIKL
+ADHETVRNVTTNRGDSITGQVIYTNLVPPNSPSVVQLMNILFRKQLKKMEMQLIGRNYFD
+PRRKIDVPAHKMQVWPGYSTSILQYEQDVMLCADVQHKVLQQTVLEFLYEIFNSNDRKNF
+YNIASKKLIGEIVLTRYQPTKTSRIDDIDWEKHPTDSFTKADGSTVTFKAYYESVYEKKV
+ADDQQPLLISRPKEKDKKRGMSGPILLLPEFCSITGLSDEIRQNFSVMKDLAQHTKISPA
+GRVKTLEGFINELYSNPEAERELSQWNMAFEKTLLKMSGRSLPAEDMFQKSAKFSYKIQE
+ADWSRETRGKELISTVNMTNWVLLYTQRDSNIANDFKQTLQRVCGPMGMQVADPQMCRLN
+SDSAQTYFSTLKEQINPQTQIVVCIVPNNRKDRYDVIKKLCCVERPVPSQVVVSRTLSKK
+QMLMSVCTKIGIQLNCKLGGEVWAVDIPLKNVMVVGFDVYHDSATKGKSIGGFVASTNRY
+LTRYYSRITSQTSHQEICNQLKVCMTGALKKYHEVNNTLPDRIIVYRDGVGDGQNSDGYE
+HELPQLKSAFSAAQANYEPKFAMLIVKKRVSTRLFLAANGQYSNPAPGTIVDSVVTRPEW
+YDFLLISQSVRQGTVTPTHYNVINDTSGLKPDHFQRLTYKLCHLYYNWPGTIRVPAPCQY
+AHKLAFLVGQSIHTEPSSHLADRLYYL
+>EU199802.1_Clytia_hemisphaerica_piwi
+MTGRARGRARGRGRAQQNAPPPGGAPPPQQSAPQAVGRGRARGGPPPAQSAPQQQAPAPR
+QQQRQQAPVAAVADQMQKMNVQEERPRQRRGIGEFKTRSFKDPATDKKGTSGEPVQILTN
+YFKVDKMPRFEGLHQYVVAFDPDIQSQKLKGFLLFSMQDVIGEVKVFDGMSLFLPRKLAE
+PVVERCVETRDGSSIKVKITHTNEVPVNSPQVVQLMGILFRRQLRHLNMQLVGRHYFNPS
+RKIDVPAHKMVVWPGFETNILQHESEVLLCANTTSKILNSQSVLEWMYEIHRQVPKDRFY
+ETVSKKLVGQIVLTRYNNKTYTVDDIAWDKHPTDTFEKADGSRISYKEYYTTAYEQAPKD
+DQQPLLLSRPKDKDRKRGVSGNIYLLPEFCSITGLSEEMRANFQVMKDLAQHTRIGPAQK
+VDILKNFMKDLNSNPESKKELSNWNMSFSSELLRLNGRKLPTQPMYQRDQKFTYQPGNAD
+WQKETRGKLLISTFNMQKWVLIFSQRDEKVAQDFLRTLKTVASPMGMRVADPQLCRLQSD
+QPRQYIQSLKEQIKPDTEIVVCIVPNNRKDRYDAIKKITCVENPVPSQVVVSRTLSKQQM
+LMSVCTKIAIQLNCKLGGEVWATEIPVKKLMVIGFDVYHDSMNKGQSIGGFIASTNDSLT
+RYYSRITKQRSHNEICSQLKICMTGALKKYREVNGHDPDRIIVYRDGVGDGQIYDVKDHE
+VPQFKAAIQEFNPNITKFSMIIVKKRVSTRLFAHSRGGISNPMPGTIVDSAVTRPEFYDF
+FLCSQTVRQGTVTPVNYNIIEDSSGLKPDHLQKLTYKLCHLYYNWPGTIKVPAPCQYAHK
+LAFLVGQSVHTDPALELSDRLYYL
+>Nanomia_bijuga_piwi
+MTGRARGRSRGRGRSDGATPGAGTPQPARPAGAPQVGRGRSRGAAPTPQQAQAPPQQRGP
+PPAAAPARAAAPPAEQMAKMTVSDNKPQQQQREQRRRKFDGEDHTLVTRNDGQVKEGTAG
+QKCSIVSNFFKVKKLPVFTGLFQYNVSFDPDIQSNKLKSALLHDLDDILGTTRCFDGMTM
+FLPKKLEEPTTTKTVTTRQGNDITIKIMFTNAVPENSPSVVQLMNILFRKQLRAMDMQLV
+GRNYYHPDRKIDIKAHKMQVWPGISTSILQYESDVMLCADVAHKVLRMQTVLEFLYEIYN
+TCNNKQGFYDIAKKKLLGEIILTRYNNKTYRIDDIDWEKHPTDSFQKADGSSITFKEYYE
+TVYEKKVNDLKQPLLISRPKEKDRKRGMDGPILLLPEFCVITGLSDEIRANFGIMKDLAQ
+HTRISPAARAQNLTQFMSDLHANPKAQAELQQWNMEFERQLLKMTGRCLGAEKMFQKDAV
+FSYKIQDADWSKETRGKALITTVNLQNWVLLHTQRDQQVAQGFVQTLKRVCGPMGMNVAE
+PTVCRLNDDQARTYFNSLNDQITQQVQMVVCIVPNNRKDRYDAIKKLCCVEKPVPSQVVV
+ARTIQKPQMLMSVCTKIGIQLNCKLGGEVWAVDIPLKKLMVVGFDVYHDSLTKGKSIGGF
+VASTNKHLTRYYSRTTSQTSHQEIADQLKVCMISSLKKYHEINQCLPDPVIVYRDGVGDG
+QIKQVYDHEVPQFKEAFAQVEPNYNPKFAMIIVKKRVSTRLFLEERNQFGNPPPGTLVDS
+VVTRPEWFDFFLVSQSVRQGTVTPTHYNVINDSSGFKADHFQRLTYKLCHLYYNWPGTIR
+VPAPCQYAHKLAFLVGQSIHTEPDASLADRLYYL
+((XP_001638494.1_Nematostella_vectensis_ago-1:0.41790545762471442703,XP_001630646.1_Nematostella_vectensis_ago-2:1.17824689497483547918)74:0.32389580671676498902,(XP_002118712.1_Trichoplax_adhaerens_ago:1.16667931714950290356,((C_30645_Daphnia_pulex_piwi-X1:1.00292447698622400054,((XP_001942742.1_Acyrthosiphon_pisum_Piwi-P1:0.87371605845602862139,(NP_476875.1_Drosophila_melanogaster_piwi-P1:1.00001188519933226218,XP_002431988.1_Pediculus_humanus_piwi-P:0.92090681549442254816)29:0.07562129128890220098)62:0.20282501565515895225,((XP_002399390.1_Ixodes_scapularis_piwi-X2:0.36223650279734059820,XP_002411770.1_Ixodes_scapularis_piwi-X1:0.57412188560566312923)100:0.49687260659603194046,((NP_500994.1_Caenorhabditis_elegans_piwi-X1:0.09672919552198509796,NP_492121.1_Caenorhabditis_elegans_piwi-X2:0.09751822543016908096)100:1.59227475051976652409,(XP_002590851.1_Branchiostoma_floridae_piwi-X:1.46460160066984679261,((XP_002611940.1_Branchiostoma_floridae_piwi-A1:1.36392046593326465853,XP_002120252.1_Ciona_intestinalis_piwi-X:0.60338454960400589311)65:0.21264221109003086929,(((NP_001073668.2_Danio_rerio_piwi-like2:0.41910815022204145341,((NP_067283.1_Mus_musculus_piwi-like2:0.04863014543208130092,NP_060538.2_Homo_sapiens_piwi-like2:0.08484359525082946218)100:0.31835428187685516077,NP_001106470.1_Xenopus_tropicalis_piwi-B:0.37827990247986326144)100:0.16311751176524844076)100:0.55911479436506628105,(((((XP_001620224.1_Nematostella_vectensis_piwi-B1:1.51386627191636113920,XP_001626127.1_Nematostella_vectensis_piwi-B2:0.10721821396934927417)75:0.35880988754547710196,XP_002162153.1_Hydra_magnipapillata_piwi-B:0.37272478927025559647)62:0.11805863597385489461,(NP_001107667.1_Strongylocentrotus_purpuratus_piwi-B:0.52248816047567225862,XP_002596179.1_Branchiostoma_floridae_piwi-B:0.45732355540455049692)34:0.06852140665284744969)14:0.09066709928591826229,((((XP_001949977.1_Acyrthosiphon_pisum_piwi-B:1.12318506416998586950,(XP_002428948.1_Pediculus_humanus_Piwi-B:1.10077817682499712326,(mk4.000945.06.01_Schmidtea_Piwi-B:1.04731275780823196442,NP_001036627.2_Drosophila_melanogaster_piwi-B:0.94217758545665841741)52:0.19545586222592473136)49:0.08191867704832012098)62:0.15138819011806065040,(XP_002433561.1_Ixodes_scapularis_piwi-B2:0.91530624955290318390,C_200184_Daphnia_pulex_piwi-B:0.67830830473945358250)61:0.15528331740437284481)31:0.10246606472021048406,(XP_002130490.1_Ciona_intestinalis_piwi-B:0.73101885020648404989,C_350064_Capitella_teleta_piwi-B:0.75727773752881077929)26:0.04441645894368441427)45:0.11315915439775919848,(XP_002413985.1_Ixodes_scapularis_piwi-B1:0.70415220486974849923,C_sca_80034_Lottia_gigantea_iwi-B:0.48295489621160664351)38:0.11227199133857369839)9:0.05453303172116054365)8:0.04511339935280656716,Amphimedon_piwi-B:0.67991877726448401997)15:0.06150246757164567341)70:0.30661372325415719997,((((NP_899181.1_Danio_rerio_piwi-like1:0.34991004736936709429,((NP_067286.1_Mus_musculus_piwi-like1:0.02949528890134741482,NP_004755.2_Homo_sapiens_piwi-like1:0.03003724900149510463)100:0.12498140001089375062,NP_001092322.1_Gallus_gallus_piwi-like1:0.19612080859657962661)100:0.13290262343895944963)77:0.06837575364734753414,NP_001008496.2_Homo_sapiens_piwi-like3:0.93926622016206995358)93:0.10255214635247501820,(NP_689644.2_Homo_sapiens_piwi-like4:0.15261056861103494686,NP_808573.2_Mus_musculus_piwi-like4:0.29044445273828956022)100:0.68420316856420759777)92:0.26052542935706002325,((e_gw1.76.55.1_Lottia_gigantea_piwi-A:0.58161130160001939249,NP_999765.1_Strongylocentrotus_purpuratus_piwi-A:0.76933419337982855701)10:0.04155008699340539263,((C_9840002_Capitella_teleta_piwi-A:0.74379778067947444065,(Amphimedon_piwi-A2:0.00393102692389606101,XP_003382553_Amphimedon_piwi-A1:0.00000122123005994819)99:0.62882216632147880375)20:0.08854235993700383667,((XP_002155913.1_Hydra_magnipapillata_piwi-A:0.36419553017521155702,(EU199802.1_Clytia_hemisphaerica_piwi:0.48323420005423439738,(AY493987.1_Podocoryne_carnea_Cniwi:0.20693259426807417145,Nanomia_bijuga_piwi:0.21485929874906437020)86:0.07373784803037010394)32:0.06470497820395215705)100:0.33249205998451408783,XP_001641994.1_Nematostella_vectensis_piwi-A:0.46100161861351462989)22:0.05738722722723369613)15:0.08126009220630753260)16:0.04348799957411497025)27:0.07775235073575220701)21:0.09271805102938186771)30:0.08907965860447250583)49:0.07669526915319589688)38:0.03421550573519403088)56:0.16904549052550169042)16:0.09230965273568031426)40:0.34010412187297589526,mk4.000158.09.01_Schmidtea_Piwi-X1:2.23745053559326612103)100:1.72806844393900727042)85:0.36653390562138804532,XP_002154701.1_Hydra_magnipapillata_ago:0.94398275680388377129);

File vasa_pl10.fas

+>NP_004651.2_Homo_sapiens
+MSHVVVKNDPELDQQLANLDLNSEKQSGGASTASKGRYIPPHLRNREASKGFHDKDSSGW
+SCSKDKDAYSSFGSRDSRGKPGYFSERGSGSRGRFDDRGRSDYDGIGNRERPGFGRFERS
+GHSRWCDKSVEDDWSKPLPPSERLEQELFSGGNTGINFEKYDDIPVEATGSNCPPHIENF
+SDIDMGEIIMGNIELTRYTRPTPVQKHAIPIIKGKRDLMACAQTGSGKTAAFLLPILSQI
+YTDGPGEALKAVKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYG
+GADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIR
+RIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVVWV
+EDLDKRSFLLDILGATGSDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREE
+ALHQFRSGKSPILVATAVAARGLDISNVRHVINFDLPSDIEEYVHRIGRTGRVGNLGLAT
+SFFNEKNMNITKDLLDLLVEAKQEVPSWLENMAYEHHYKGGSRGRSKSNRFSGGFGARDY
+RQSSGSSSSGFGASRGSSSRSGGGGYGNSRGFGGGGYGGFYNSDGYGGNYNSQGVDWWGN
+>NP_001347.3_Homo_sapiens
+MSHVAVENALGLDQQFAGLDLNSSDNQSGGSTASKGRYIPPHLRNREATKGFYDKDSSGW
+SSSKDKDAYSSFGSRSDSRGKSSFFSDRGSGSRGRFDDRGRSDYDGIGSRGDRSGFGKFE
+RGGNSRWCDKSDEDDWSKPLPPSERLEQELFSGGNTGINFEKYDDIPVEATGNNCPPHIE
+SFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPILS
+QIYSDGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVV
+YGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQ
+IRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVV
+WVEESDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDR
+EEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGL
+ATSFFNERNINITKDLLDLLVEAKQEVPSWLENMAYEHHYKGSSRGRSKSSRFSGGFGAR
+DYRQSSGASSSSFSSSRASSSRSGGGGHGSSRGFGGGGYGGFYNSDGYGGNYNSQGVDWW
+GN
+>NP_036138.1_Mus_musculus
+MSQVAAESTAGLDQQFVGLDLKSSDNQNGGGNTESKGRYIPPHLRNRETSKGVCDKDSSG
+WSCSKDKDAYSSFGSRDSRGKPNYFSDRGSGSRGRFDDHGRNDYDGIGGRDRTGFGKFER
+SGHSRWSDRSDEDDWSKPLPPSERLEQELFSGGNTGINFEKYDDIPVEATGNNCPPHIEN
+FSDIEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPILSQ
+IYTDGPGEALKAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVY
+GGADTVQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQI
+RRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVVW
+VEELDKRSFLLDLLNATGKDSLTLVFVETKKGADSLENFLFQERYACTSIHGDRSQKDRE
+EALHQFRSGRKPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLA
+TSFFNERNLNITKDLLDLLVEAKQEVPSWLESMAYEHHYKGSSRGRSKSRFSGGFGARDY
+RQSSGSANAGFNSNRANSSRSSGSSHNRGFGGGGYGGFYNNDGYGGNYNSQAVDWWGN
+>NP_034158.1_Mus_musculus
+MSHVAVENALGLDQQFAGLDLNSSDNQSGGSTASKGRYIPPHLRNREATKGFYDKDSSGW
+SSSKDKDAYSSFGSRGDSRGKSSFFGDRGSGSRGRFDDRGRGDYDGIGGRGDRSGFGKFE
+RGGNSRWCDKSDEDDWSKPLPPSERLEQELFSGGNTGINFEKYDDIPVEATGNNCPPHIE
+SFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPILS
+QIYADGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVV
+YGGAEIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQ
+IRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVV
+WVEEIDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDR
+EEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGL
+ATSFFNERNINITKDLLDLLVEAKQEVPSWLENMAFEHHYKGSSRGRSKSSRFSGGFGAR
+DYRQSSGASSSSFSSSRASSSRSGGGGHGGSRGFGGGGYGGFYNSDGYGGNYNSQGVDWW
+GN
+>NP_149068.1_Mus_musculus
+MSHVAEEDELGLDQQLAGLDLTSRDSQSGGSTASKGRYIPPHLRNREAAKAFYDKDGSRW
+SKDKDAYSSFGSRSDTRAKSSFFSDRGGSGSRGRFDERGRSDYESVGSRGGRSGFGKFER
+GGNSRWCDKADEDDWSKPLPPSERLEQELFSGGNTGINFEKYDDIPVEATGNNCPPHIES
+FSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPILSQ
+IYTDGPGEALRAMKENGKYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVY
+GGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQI
+RRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVVW
+VEEADKRSFLLDLLNATGKDSLILVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDRE
+EALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLA
+TSFFNERNINITKDLLDLLVEAKQEVPSWLENMAFEHHYKGGSRGRSKSRFSGGFGARDY
+RQSSGASSSSFSSGRASNSRSGGGSHGSSRGFGGGSYGGFYNSDGYGGNYSSQGVDWWGN
+>NP_001025971.1_Gallus_gallus_Pl10
+MSHVAVENALSLDQQFSGLDLNSSDSQSEGSATSKGRYIPPHLRNREASKQGFDSGGWST
+SRDKDAYSSFGARSDRGAKSSFFDRGNGSRGGRYEERGRGSDYDRSGFGRFDRGGNSRWC
+DKSDEDDWSKPLPPSERLEQELFSGSNTGINFEKYDDIPVEATGSNCPPHIESFSDVDMG
+EIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPILSQIYADGPG
+DALRAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFAYRSRVRPCVVYGGADIGQ
+QIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQD
+TMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVVWVEELDKR
+SFLLDLLNATGKDSLTLVFVETKKGADALEDFLYHEGYACTSIHGDRSQRDREEALHQFR
+SGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNER
+NINITKDLLDLLVEAKQEVPSWLENMAYEQHHKGGGSRGRSKSRFTGGFGARDYRTSSGA
+GSSSFSSSRPASGRTGGSGSRGFGGGGYGGFYNSDGYGGNYNSQGVDWWGN
+>NP_989196.1_Xenopus_tropicalis_Pl10
+MSHVAVENVLSLDQQFAGLDLNSADAQSGGSATKGRYIPPHLRNKEASRQDANWDAGRGG
+NGYVNGTNDDRDSRMNGYDRSGYGNRGSGRTDRGFYDRENSGWNSGRDKDAYSSFGSRGE
+RGKPSLFNDRGGSGSRRPDDRRPDGYDGMANRGDRSGFGRFDRGNSRWSDERNDEDDWSK
+PLAPNDRVEQELFSGSNTGINFEKYDDIPVEATGNNCPPHIESFQDVTMGEIIMGNIQLS
+RYTRPTPVQKHAIPIIIEKRDLMACAQTGSGKTAAFLLPILSQIYADGPGDAMKHLKENG
+RYGRRKQFPLSLVLAPTRELAVQIYEEARKFAYRSRVRPCVVYGGADIGQQIRDLERGCH
+LLVATPGRLVDMMERGKIGLDFCNYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRQT
+MMFSATFPKEIQILARDFLDEYIFLAVGRVGSTSENITQKVVWVEEMDKRSFLLDLLNAT
+GKDSLTLVFVETKKGADALEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVAT
+AVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNEKNINITKDLLD
+LLVEAKQEVPSWLENMAYEQHHKSSTRGRSKSRFSGGFGARDYRQSSGASSGFGGSSRGG
+RSSGHGGSRGFGGGYGGFYNSDGYGGNYGGSSQVDWWGN
+>NP_571016.2_Danio_rerio_Pl10
+MSHVAVENVHGLDQQLAALDLSSADVQGVTGRRYIPPHLRNKEAAKNDAPGGWDNGRSNG
+FVNGYHDGRDNRMNGGSSFAGRGPIRSDRGGRGGFRGFGYDNKEAGGWNVPKDNAYNSFG
+GRSDRGKSSFFNDRGSSSRGRYERGGFGGGGNSRWVEECRDEDWSKPLPPNERLEHELFS
+GSNTGINFEKYDDIPVEATGHNGPQPIDRFHDLEMGEIIMGNINLSRYTRPTPVQKHAIP
+IIKSKRDLMACAQTGSGKTAAFLLPVLSQIYTDGPGEALQAAKNSAQENGKYGRRKQYPI
+SLVLAPTRELALQIYDEARKFSYRSHVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLL
+DMMERGKIGLDYCNYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGLRQTMMFSATFPKE
+IQILARDFLEDYIFLAVGRVGSTSENITQKVVWVEENDKRSFLLDLLNATGKDSLTLVFV
+ETKKGADALEDFLYREGYACTSIHGDRSQRDREEALHQFRSGRCPILVATAVAARGLDIS
+NVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNDKNGNITKDLLDILVEAKQEVP
+SWLESLAYEHQHKSSSRGRSKRFSGGFGARDYRQNSSSGGGGFGGRGGRSTGGHGGNRGF
+GGGKGGFGNFYSSDGYGGNYSQVDWWGN
+>NP_001119895.1_Danio_rerio_Pl10-a
+MSHVVVDGSHGLDQQLAVLDLNSADGQGVGTGRRYIPPHLRNKDASKNDSPGWDGSRTNG
+FVNGYHDSRMNGTANFARGPLRNDRGGRGGFRGNRNGASFNQPVHNAGYGTYENKDGGWN
+SVVNRDAYASFGGRSDRGKSAFFNDRGASSRGRYERGGFGGGTGGNSRWVEESRDEEDWS
+KPMPPNERLEHELFSASNTGINFEKYDDIPVEATGTNSPGHIESFHDVDMGEIIMGNITL
+SRYTRPTPVQKYAIPIIKTKRDLMACAQTGSGKTAAFLLPVLSQIYSEGPGEALQATKAS
+TQQENGKYVRRKQYPISLVLAPTRELALQIYDEARKFAYRSRVRPCVVYGGADIGQQIRD
+LERGCHLLVATPGRLVDMMERGKIGLDYCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPP
+KGSRQTMMFSATFPKEIQILARDFLEEYIFLAVGRVGSTSENITQKVVWVEENDKRSFLL
+DLLNATGKDSLTLVFVETKKGADALEDFLYREGYACTSIHGDRSQRDREEALHQFRSGRC
+PIMVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFYNDKNSNI
+TKDLLDILVEAKQEVPSWLENLAYEHQHKSTNRGRPKRFSGGFGARDYRQMPGGGNTFGN
+RGARNTGGHGGNRGFGGNKGGFGSFGGDSYGGTYGNYGGNYTQVDWWGN
+>XP_002131481.1_Ciona_intestinalis_Pl10
+MTHATNGLEQQMSQMDISAGRGGGQARFNSAGGYVPPHMRNQAMGRGGPPQVLHGPPPSY
+GGAPMTGPNGEVRYGHLMPGPPPGSMPPGSYGAPPQRGGYQNGVMRDRNGPPNRYNDRGP
+YRPPHQQYMGYGGGYNDRGRGGYNDRGYNDRRGFWDGQQQQQPQVADRWARLDDGMNSGR
+YGQPREGDDRLAKKWDERQGGGDAFTDTVDWSKPLPRDENLERNLFSGSNTGINFDKYED
+IPVEATGDDVPEHIENFKQAELGEIVDDNLESCKYTVPTPVQKYAIPIIQSKRDLMACAQ
+TGSGKTAAFLLPTLSQLYTKGPGESLKATTSHQRGRRKLFPLALVLSPTRELASQIYDEA
+RKFAYRSHVRPCVVYGGADVGAQMRDLDRGCHILVATPGRLVDFIERGKVGLCYIRFVIL
+DEADRMLDMGFEPQIRRIVEQSDMTHKGERQTLMFSATFPKEIQILARDFLNNYIFLAVG
+RVGSTSTNITQKVVWVDEEEKHKFLLDLVNATDSKSLTLIFTETKKGADALDEFLYTRKY
+KSTSIHGDRTQREREEALLAFRTGEYPILVATAVAARGLDIPNVRHVINFDLPSDVDEYV
+HRIGRTGRVGNIGLATSFFNNKNVNIVKDLVDLLIEASQEVPPWLENMALTYQKGKPRSS
+GKRFSAGFGSRDYRQQQNRGGSRGGGNAGRGSQIQNRGTQGGGWGMPAFYRGNDYGGSFG
+NTGGSGPDWFGGN
+>XP_002593182.1_Branchiostoma_floridae_Pl10
+AVDKGRYIPPHVRNRQTNDFGPQNSGGFNRRGGGFNRNFGGRDNRNFGGGNQWDGGRQNN
+RWDRSNEQPSNNRWSRDDRKAGGDNYPPPEDADWSKPLPRNERMERELFGKSNTGINFDK
+YEDIPVEATGESCPQHISEFTDLDLGEIISNNIKLSNYMKPTPVQKYAIPIARANRDLMA
+CAQTGSGKTAAFLIPILSLIYENGPQGLPQHGRQYGGSGSRKRYPLALVLAPTRELASQI
+YDESKKFAYRSHVRPCVVYGGADIGGQMRDLERGCHLLVGTPGRLVDMMERGRIGLDYIK
+YLILDEADRMLDMGFEPQIRRIVEQDTMPGTGKRRTMMFSATFPKEIQMLARDFLDNYIF
+LAVGRVGSTSDNITQKVVWVDEQDKRSFLLDLLNATGKEDSLTLTFVETKKGADSLEAFL
+YSEGYPVSSIHGDRSQREREDALMTFRTGVTPILVATAVAARGLDIPNVKHVINFDLPSD
+IDEYVHRIGRTGRVGNLGLATSFFNDKNRNVVRDLVDILIESKQELPPWLESMAYEERRQ
+QSSGRNRGRNRSAFQGGFGSRDYRQQNRSGGAQQRGGAPSYGGFTHYQPAQGYGGYPPGA
+MRQHDQQSFDWWGN
+>XP_795982.2_Strongylocentrotus_purpuratus_Pl10
+MSVRVGMIGEQWRTSFSYRSHVRPCVVYGGADIKGQISDLERGCHLLVATPGRLVDMLER
+GRIGLEYIRWVVLDEADRMLDMGFEPQIRRIVEEDAMPKTGERQTLLLTSLFLQVLARDF
+LKDYIFLAVGRVGSTSSNITQKIVWVEEQDKRSFLLDLISAAGADSLTLVFVETKKGADS
+LEEFLYREKFQATSIHGDRSQREREDALKTFRTGRTPILVATAVAARGLDIYNVKHVINF
+DLPTDIEEYVHRIGRTGRVGNVGLATSFFNEKNRNISRDLADLMIEAKQEVPSWLEALAS
+ESKNSGGSSRRGRNRYTGGFGSRDYRQVSNRGRGGGSGGVSGGFGGHQSSGGHGAPGYQP
+HYGGNYGGSYNQSSGGGGSGQDWWGN
+>XP_001747837.1_Monosiga_brevicollis_Pl10
+MSNGANPNGSDLSQHMADLDLTKTKPSGGSRYVPPHLRNRQPSGPAPPSGGRTAAPPVSA
+PPPSSNGGGRDFGSSRPPRGSRDGSRDMGGSRPPRDGGRGGSWDVQPRFQQEDWTRPLKR
+NERMEEELFGSNHRTGGINFEKYDDIPVEASGNNVPAHISEFATAGLCELMTGNLELARY
+TVPTPVQKYSIPIVQAKRDLMACAQTGSGKTAAFLVPILNRVYETGPVPPPPNARRSQQF
+PVALILAPTRELAIQIYGEAQKFSYRSRVRICCVYGGASPRDQIQDLRRGCQLLVATPGR
+LVDFMERGVIGLDSIRFLVLDEADRMLDMGFEPQIRRIVEEDNMPQVGIRQTLMFSATFP
+KDIQMLAQDFLDDYVHLSVGRVGSTSENIQQIVHWIDEADKRPSLLDLISAASSEDLFLI
+FVETKKAADALEYYLTMQGRPATSIHGDRTQYEREEALADFRAGRRPILVATAVAARGLD
+IPNVKHVINFDLPSDIDEYVHRIGRTGRAGHKGTAVSFFNDKNRNVARDLLN
+>XP_002118053.1_Trichoplax_adhaerens_Pl10
+MVGGGGGGGRFNRNQGRFDDRGGNNNHFYGAGRGGGNRNNYGNGPGSGYGYRRDDRQGKS
+SWTVPLPRNERIERNLFGNANTGINFSKYQDIPVEATGSNCPKHIEEFNQCDLGEIILGN
+IELCQYNIPTPVQKYAISIITGKRDLMACAQTGSGKTAAFLIPILSLIFNGGPVVKPQSY
+YGSRRKQFPLALILAPTRELAAQIYEEAKKFTYRAVARPCVVYGGADFGYQVKDLDRGCH
+LLVATPGRLVDMLERGMIGLDYCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPSGQRQT
+MMFSATFPKEIQVLARDFLDDYIFLAVGRVGSTSENIIQKMVWVEEDDKRAYLLELLNST
+EPTSLSLVFVETKKGADSLQEFLVRMGYYSTAIHGDRSQRDREDALRAFRAGVRPILVAT
+AVAARGLDIPNVAHVINFDLPSDIEEYVHRIGRTGRVGNVGTATSFFNEKNKNVAKDLVD
+LLLEAKQSVPRWLDDVAVEMRYQSNNKRGGRRYSTNFCYCFHGS
+>XP_002156523.1_Hydra_magnipapillata_Pl10
+MSHVVQNDVHGLGQRVAGLDLNKQSNQQGSRYIPPHLRGQQQVGPAGPQKNIIPQYFENP
+SRGGYQQNFNRGGGGGYNSQYQHQNYNGYSKNTSYNGNQSNRGEQFLWNSERGSRWETND
+ALSNADWSKLLPRNERLEMELFTSAQSGINFDKYEDIPVEATGSNTPKSIETFDEANLGE
+IILTNISLAHYTKPTPVQKNSIPIIKAKRDLMACAQTGSGKTAAFLVPILSRIFEEGPFE
+NPSNVRQGGKKKQYPIALVLAPTRELASQIYDESRKFVYRSCIRPCVVYGGADVSTQMRD
+IDRGCHLLVATPGRLVDMIQRGKVGLECIKFLVLDEADRMLDMGFEPQIREIVEKCDMPR
+TGERQTLMFSATFPKEIQMLARDFLDNYIFLAVGRVGSTSENITQKVVWVEEHDKREFLL
+DLLNASGPDSLTLVFVETKRGADALEQFLFRCPENYHATSIHGDRHQKEREQALASFRVG
+TTPILVATAVAARGLDIPNVKHVINFDMPSDIEEYVHRIGRTGRVGHTGLATSFFNDKNR
+NVARDLMDILAEAKQEIPSWLESMGYQAQQHQAAKKAQKTNRYGGGGGGFGGRDYQPTYN
+HQPAYQQNNYRGTGGRAHSNNSDDWWEK
+>XP_001627306.1_Nematostella_vectensis_Pl10
+MSHVAHGNNQSLDQRFAGLDLNSGVGQSPDAGRNPNQPTQQRYIPPHLRGKQQSQNFVDP
+RNFGGYGGPPRDQNWGRDPREGWGGNRDNYSRGGGGGYNRGYGSGGGYGGGGYNKRGGRY
+SGGSNWGSSPAGDDRDYGYGQQHPPEDWSKLQPKNERVERDLFASHNTGINFEKYDDIPV
+EATGQECPKNIELFEDVDLGEILLHNVGLAGYKKPTPVQKYAIPIVKGKRDLMACAQTGS
+GKTAAFLIPILSRIYMEGPPAPPDIKHAGRRRQYPICLVLAPTRELAVQIFDEARKFSYR
+SLCRPCVVYGGADIGSQLRELDRNCHLLVATPGRLVDMMDRGRVGLDSIRFLVLDEADRM
+LDMGFEPQIRRIVDQDSMPKTGIRQTLMFSATFPKEIQMLARDFLENYIFLAVGKVGSTS
+ENITQKVVWVDEFDKRSFLLDLLNASGPQQLTLVFVETKKGADALEMFLAKDGYYCTSIH
+GDRSQREREEALRTFRCGDTPILVATAVAARGLDIPNVKHVINFDLPTDIEEYVHRIGRT
+GRVGHTGLATSFFNHKNKNVAKELMDILEESKQEIPSWLESMAYEASSGSRNRGRRHGGG
+GGAFSSRDYRQHRGGSSGGGMHGGGGGYGNYGGYGGYGGNPQGGYGFAGYGGQYGGPRGG
+GSGGQDWWN
+>NP_497615.2_Caenorhabditis_elegans_Pl10-a
+MESNQSNNGGSGNAALNRGGRYVPPHLRGGDGGAAAAASAGGGNRGYNNNRGGGGGGYNR
+QDRGDGGSSNFSRGGYNNRDEGSDNRGSGRSYNNDRRDNGGDGQNTRWNNLDAPPSRGTS
+KWENRGARDERIEQELFSGQLSGINFDKYEEIPVEATGDDVPQPISLFSDLSLHEWIEEN
+IKTAGYDRPTPVQKYSIPALQGGRDLMSCAQTGSGKTAAFLVPLVNAILQDGPDAVHRSV
+TSSGGRKKQYPSALVLSPTRELSLQIFNESRKFAYRTPITSALLYGGRENYKDQIHKLRL
+GCHILIATPGRLIDVMDQGLIGMEGCRYLVLDEADRMLDMGFEPQIRQIVECNRMPSKEE
+RITAMFSATFPKEIQLLAQDFLKENYVFLAVGRVGSTSENIMQKIVWVEEDEKRSYLMDL
+LDATGDSSLTLVFVETKRGASDLAYYLNRQNYEVVTIHGDLKQFEREKHLDLFRTGTAPI
+LVATAVAARGLDIPNVKHVINYDLPSDVDEYVHRIGRTGRVGNVGLATSFFNDKNRNIAR
+ELMDLIVEANQELPDWLEGMSGDMRSGGGYRGRGGRGNGQRFGGRDHRYQGGSGNGGGGN
+GGGGGFGGGGQRSGGGGGFQSGGGGGRQQQQQQRAQPQQDWWS
+>NP_491113.1_Caenorhabditis_elegans_Pl10-b
+MNTQYYANHNGQQQPPQQQQGQGWSSSYSQQSNNMPAGGVFYNGFANGTPSNNGSSGYNN
+FADSGNGFNNNGAESNQWGGAPAEYSESNLFHRTDSGINFDKYENIPVEVSGDSVPAAIE
+HFNEAGFGPAVMENVNRSGYSKPTPVQKHSIPTLLANRDLMSCAQTGSGKTAAFLLPIIQ
+HILAGGPDMVKPPAFTNGRRTYYPCALVLSPTRELAIQIHKEATKFSYKSNIQTAILYGG
+RENYRDQVNRLRAGTHILIATPGRLIDIIEQGFIGLAGCRYLVLDEADRMLDMGFEPQIR
+KIVGQGMPPKTARTTAMFSATFPKEIQVLAKDFLKDNYIFLAVGRVGSTSENIEQRLLWV
+NEMEKRSNLMEILMNEHSENLVLVFVETKRGANELAYFLNRQQIRSVSIHGDLKQIERER
+NLELFRSGQCPILVATAVAARGLDIPNVRHVINYDLPGDSDEYVHRIGRTGRCGNLGIAT
+SFFNDKNRGIGRDLKNLIVESNQEVPEWLHQVAAEGRIGGGQRGGNRRFGATDYRVGRGG
+GGSFGGNFSNYNSGGATGGFGSGPAYGGSFGGGAPRRPFTNGGFGAHSSLSSTSNSGGGG
+GFSGPRRGGFNSGMNRQGGGGGGFYSNPGQAPIDHWQAPQA
+>XP_001894695.1_Brugia_malayi_Pl10-a
+MNSGNFGYGSQNFDNGYQYVKGAPGSEGWTGGEAPGAQLPLPPNATAPTPRSNDALPQHE
+SRYVPPHMRHAAATSPETIPEGAPVYENWSRGPQQYVRSGRGSGGTFGDRSASMRKSQSY
+AGMQPVQNDYTVQWSNNASVHGYDYQPCVGGRPGRGRAGFGQPVSGFNRSDGHVRGRGNY
+GDSHGSTRGRPNYSGRYSYDRRAVHDEQQWGSQHQSGFRRQDDTLPDNPRWAGLRDPLPE
+RPVQWTEQLPRDELLESELFAGMNSGINFDKYEEIPVEATGQDCPPPIALFADLKLHPWI
+EGNIRLSGYGRPTPVQKYSIPTLMNNRDLMSCAQTGSGKTAAFLVPLINNVLQAGPEALY
+KSTTQQNGRRRQYPAALILSPTRELSLQIYNESRKFAYRTPITSALLYGGRENYREQINK
+LRLGVHILIATPGRLIDVMEQGLIGLDGCRFLVLDEADRMLDMGFEPQIRQIVDLSKMPP
+KGQRVTAMFSATFPKEIQVLAQDFLMPNYVFLAVGRVGSTSENIMQKIVWVEEHEKKSFL
+MDLLDAGEPSALTLVFVETKRGASDLAYYLQKDGYNVVAIHGDLKQFDREKHLETFRSGV
+ATILVATAVAARGLDIPNVKHVINYDLPSDIDEYVHRIGRTGRVGNVGLATSFFNDKNRN
+IARDLAELVVEANQELPEWLEKISADAQRYGTRPGRAKGGSRFGGRDHRVQYTGGSGGGG
+SHRQNGINYSPSNNQWNQPQRTARAPPQQDWWNN
+>XP_001894443.1_Brugia_malayi_Pl10-b
+MSATSDNILPQEGSRNEIVERLTLRDNYIISIHYVTVRDENYFYLSGYKITFYLLGVNCG
+INFDKYEKIPVLATGSDVPFPCAVFDELQLHPWIQENIKKSGYTKPTPVQKYSIPSLLNC
+RDLMSCAQTGSGKTAAFLIPVINHIIQNEPTAMKMSHMNRRTVFPVALILLPTRELAMQT
+HKEALKFAYRTNVLSAVLYGGRENYRDQVQKLMLGCHMLIATPGRLLDLMNQNVVSLHEC
+RFLILDEADRMLDMGFEPQIRQIVEYHSMPEKGKRVTALFSATFPKEIQVLAQDFLVPNY
+VFLSVGRVGSTSENIVQKVIWVEEHDKKRLLMELLDTDVNKGLTLIFVETKRGANELAWH
+LQRNH
+>NP_536783.1_Drosophila_melanogaster_Pl10
+MSNAINQNGTGLEQQVAGLDLNGGSADYSGPITSKTSTNSVTGGVYVPPHLRGGGGNNNA
+ADAESQGQGQGQGQGFDSRSGNPRQETRDPQQSRGGGGEYRRGGGGGGRGFNRQSGDYGY
+GSGGGGRRGGGGRFEDNYNGGEFDSRRGGDWNRSGGGGGGGRGFGRGPSYRGGGGGSGSN
+LNEQTAEDGQAQQQQQPRNDRWQEPERPAGFDGSEGGQSAGGNRSYNNRGERGGGGYNSR
+WKEGGGSNVDYTKLGARDERLEVELFGVGNTGINFDKYEDIPVEATGQNVPPNITSFDDV
+QLTEIIRNNVALARYDKPTPVQKHAIPIIINGRDLMACAQTGSGKTAAFLVPILNQMYEL
+GHVPPPQSTRQYSRRKQYPLGLVLAPTRELATQIFEEAKKFAYRSRMRPAVLYGGNNTSE
+QMRELDRGCHLIVATPGRLEDMITRGKVGLENIRFLVLDEADRMLDMGFEPQIRRIVEQL
+NMPPTGQRQTLMFSATFPKQIQELASDFLSNYIFLAVGRVGSTSENITQTILWVYEPDKR
+SYLLDLLSSIRDGPEYTKDSLTLIFVETKKGADSLEEFLYQCNHPVTSIHGDRTQKEREE
+ALRCFRSGDCPILVATAVAARGLDIPHVKHVINFDLPSDVEEYVHRIGRTGRMGNLGVAT
+SFFNEKNRNICSDLLELLIETKQEIPSFMEDMSSDRGHGGAKRAGRGGGGRYGGGFGSRD
+YRQSSGGGGGGRSGPPPRSGGSGSGGGGGSYRSNGNSYGGNSGGGGYYGGGAGGGSYGGS
+YGGGSASHSSNAPDWWAQ
+>XP_002424996.1_Pediculus_humanus_Pl10
+MSNVPNQNGSGLEQQLAGLDLQSGQSQKNSALVGRYIPPHLRKKQLSGSGEDNHYSERDS
+SSANRDYNRHENRGGGSSGYRGGQGSGGRVSSSSDYSNFSRNNKRYDDRSCANGGDSYDR
+DRRSYGTLFIFRDAWRSNSGNRGGNNSGNRWQDRDDGPPVRNDRWQEPVRDDRRYSDRRG
+ERGGGSSRWKENSESGWTVPTARDERLEIELFGTGNTGINFSKYEDIPVDATGENVPPHI
+ESFSEIKMTEIISNNIMLARYDKPTPVQKYAIPIIMSRRDLMACAQTGSGKTAAFLVPIL
+NQMYQRGPQNNRPYSHRKQYPMGLVLAPTRELATQIYDEARKFSYRSRLRPCVVYGGSYL
+QDQFRELEKGCHLLVATPGRLADMLDRDKIGLENCKFLVLDEADRMLDMGFEPQIRRIVE
+KDMPRTGERQTLMFSATFPDVIQADKRSFLLDLLNATRYKNGTESLTLVFVETRKGADCL
+EEYLHYQGYPVSCIHGERSQREREDALRRFRSGETPILVATAVAARGLDISHVTHVINFD
+LPSDIEEYVHRIGRTGRMGNLGVATSFFNEKNRNIVRDLVELLTETNQDLPKWLEAFASD
+MNAPQTSRRGGGSKTRFGGGFGARDYRQQSNSRSGGNQNSRSGYNSYGSGNPSHQGFYMN
+HESGYGGSYSTPNNSSNGPDWWGS
+>XP_001605842.1_Nasonia_vitripennis_Pl10
+MSNADNQNGSGLEQQLAGLDLQDSRQSSGGRYVPPHLRNKSATSNRVVDEPDSFSDSPQG
+GDRPPLSSQGGRFGDRGGDRDRGRGLGGGGGGPGGGGGYGRRNDADFGNFGGRNRRQENG
+RDYRYERDAPRSGGNDRWQEQPRGNDRWQDNGRNDRMGGGGGGRWNDDDRRGGGGGGKQI
+DWTIPTARDERCELELFGERSTGINFSKYEDIPVEASGEDIPPHISSFDEVKLTEIIKNS
+INLAGYDKPTPVQKYAIPIIIGRRDVMACAQTGSGKTAAFLVPILNQIYESGPPPLPPNA
+SGRRKQYPLGLVLAPTRELATQIYDEARKFAYRSRMRPAVVYGGSNMVEQLRELDRGCHL
+LVATPGRLVDMLGRGKIGLHNCRYLVLDEADRMLDMGFEPQIRRIVEQDTMPPTGERQTL
+MFSATFPKEIQMLARDFLSNYIFLAVGRVGSTSENITQKIVWVEEHEKRSYLLDLLGACN
+FQEPTQESLTLVFVETKKGADMLEEFLHNQHYPVTSIHGDRSQHEREDALRRFRSGHTPI
+LVATAVAARGLDIPHVKHVINFDLPGDVEEYVHRIGRTGRMGNLGLATSFFNSKNQNLVR
+DLVSLLVEANQELPHWLEDMCSDSRHGGGASRRPAAKGRFSGGGFGARDYRQSSGGGGPP
+SRSSGPPGRPGGYGGGYGGGGGYGGNYNSSYNSSNNSGGGSDQDWWAS
+>NP_001153721.1_Tribolium_castaneum_Pl10
+MSNAPNQNGSGLEQQFAGLDLQSRAPSGRYVPPHLRNKQSSAESSYDRDRGESRGGSGRS
+NYSSRGGGRDNRAGDYSSFNTRNRRDNFQNGETFEREEWGRGGGGGGGGRQQERERDLPR
+NDRWQEPEKPREGGGGRWSDNRNENRGGGGGGGGGGGRWNDNRDRHNENDWTVPMPRDER
+LEQELFGTGNTGINFSKYEDIPVEATGDKVPRHITSFEEVQLTEIIRNNINLARYDTPTP
+VQKYAIPIIVGKRDVMACAQTGSGKTAAFLVPILNQMYEHGPPNITHGRSRRKQYPLGLV
+LAPTRELATQIYDESKKFAYRSRVRPCVVYGGAHIGDQMRDLDRGCHLLVATPGRLLDMI
+DRGRIGLDYCRYLVLDEADRMLDMGFELQIRRIVEKETMPKTGERQTLMFSATFPSPIQM
+LARDFLDNYIFLAVGRVGSTSENITQKVVWVEEHDKRSFLLDLLNAAEMSQPSAESLTLV
+FVETKKGADSLEEFLHFEGYPVTSIHGDRSQREREDALRQFRSGNTPILVATAVAARGLD
+IPHVKHVINFDLPSDIEEYVHRIGRTGRMGNLGLATSFFNDRNRNLASGLLDLLIEAKQE
+YPSWLEGVAADGRMPSSGRRGGKSRYGGGGGSSFGGRDYRQQSGGMSRNQRSGGGGGYGN
+NGFGNNGGGHYGGLDRGGNFGGNYNSNSNSNSRDDWWEN
+>XP_391829.3_Apis_mellifera_Pl10
+MSNAANQNGSGLEQQLAGLDLQGSRQPSGGRYVPPHLRNKSGSNAPSGGDHHFSSNSRPY
+SDRDRGRDRDRERERERDRDRGRGGSGYRDTRSRDVDFGNFGNFGGRTRRSANQENGRDY
+RYSNSDRERDRDRTVNSGNDRWQEPRNDRWPDNRNDHRMGGGRWKDDREGGRTNSEIDWT
+IPTSRDERLEVELFGTGNTGINFSKYEDIPVEATGDNIPPHITSFDEVKLTEIIKNSISL
+AGYDKPTPVQKYAIPIIIGRRDVMACAQTGSGKTAAFLVPILNQIYESGPRPPPINSSGK
+RKHFPLGLVLAPTRELATQIYDEARKFAYRSRMRPAVVYGGSNIVDQMRELDRGCHLLVA
+TPGRLVDMLGRGKIGLHNCRYLVLDEADRMLDMGFEPQIRRIVQEDTMPPTGERQTLMFS
+ATFPKEIQMLARDFLSNYIFLAVGRVGSTSENITQKIVWVEEHDKRSYLLDLLQASNFSD
+PSAESLTLVFVETKKGADMLEEYLHQMGYPVTSIHGDRTQREREDALRRFRAGKAPILVA
+TAVAARGLDIPHVKHVINFDLPGDVEEYVHRIGRTGRMGNLGLATSFFNNKNINLVRDLV
+SLLVEANQELPPWLDDMFSEARYSGGGSRRAGSTKGRFSGGFGARDYRQQPSSGSARNNG
+SSNRPGSYGGSYGNYGGNYNNSSYNNSANNVNSNDPDWWDK
+>XP_001950362.1_Acyrthosiphon_pisum_Pl10
+MSNVPNQNGSGLEQQFAGLDLQGNSQPSSAPSKYVPPHLRNRPDNSEAVEPESVDTDRDF
+NAPRQPSGNDRRGGRRDDYEDRSYNGSSSSGYGGVRGGGGYRGNYRNDRDGGDWSRFNQG
+GSRWQEGNGGRRSGENRRGRWDESSAPNQDWTKPLPPDERLEEELFGNNSTGINFKNYED
+IPVEATGEDIPSHIDTFDDIKLTDIIRMNIALTRYDTPTPVQKYAIPIIVGRRDVMACAQ
+TGSGKTAAFLVPILNQIYEKGPAAYNSRRKYPLGLILAPTRELATQIYDEAKKFAYRSRV
+RPCVVYGGSHVMDQIRDLEQGCHLLVATPGRLVDMLERGKIGLDFCRYLVLDEADRMLDM
+GFETQIRRIVEKDSMPPPGDRQTLMFSATFPKEIQMLARDFLDNYIFLAIGRVGSTSENI
+TQKIVWVEDRNKRSYLLDLLNATPIRSKPAESLILVFVETKKGADSLEEFLYSNGYPVTS
+IHGDRTQREREDALKSFRSGNTPVLVATAVAARGLDIPHVTHVINYDLPSDVEEYVHRIG
+RTGRMGNLGLATSFFNDKNRNLTRDLMELITESKQELPGWLESMAVDFRMSSGRRSNGAK
+GGSRFGGAGFGSRDYRTTSSMPPRGGSSGPPRRDYGGGSNNGGGFYGGGNYGGSYNSGGA
+ASNGNSSTQDWWSQS
+>XP_002435863.1_Ixodes_scapularis_Pl10
+EAAREGWGGGGGGGGGGSRDDQRGGGGGGGNWDRRNGGRRNYDEPAASLCCRELFSQGHT
+GINFEKYEDIPVEATGEDSAKHINSFDECSLTEIIRVNIELAHYTCPTPVQKHAIPIILA
+KRDLMACAQTGSGKTAAFLVPILNQVFEDGPPKNQYPLALILSPTRELACQIYEEACKFA
+YRSRVRPCVVYGGADPMQQMKDLDRGCHLLVATPGRLVDMMERGKVSLELVRYLVLDEAD
+RMLDMGFEPQIRRIVLEDNMPPVGQRQTLMFSATFPKKVQELARKFLDNYIFLAVGRVGS
+TSENITQKVVWVEEHDKRSFLLDLLNAAGLRTGSQAALSDSLTLTFVETKKGADSLEHFL
+MKEGYPVTSIHGDRSQREREDALWSFRKGHTPILVATAVAARGLDIPNVKHVINFDLPSD
+IEEYVHRIGRTGRVGNLGLATSFFNEKNRNMALDLVELITETKQELPDWLAALAKEVQGE
+QRATNQRRFGSGGR
+>C_1450007_Capitella_teleta_Pl10
+MTDEANQNGQSLEQQVAAIDLNGAGGPANGAPNGANNTSKYVPPHMRNQPGGDMTQGPPP
+PQMAQSPPLNNFTMPPPPAGQPPPMQDAVAEPKYNSLPRGSSSDMRGGGRGGATRGSGNM
+RGWSADRDLEVEGGRQEWGRGPPRRGSQDQQGWTGGRNNYNSRGGGGGGWDNQEPPRDGG
+GRWDNNSGGWDQRDGGRSNSRERRGGSGWGGGNDRYQGGQQRMGGGGGRWDNLDQGGQGG
+RDQGGRWGGNQQQGGGGNNRWDRGERSQQQGAYDGGGRWSRLDEGPTGIDWSKPLSRNER
+LEHELFGNSNTGINFDKYESIPVEATGEGAPKPIEKFTDIHLGEIIDTNIELCKYTCPTP
+VQKYAIPVIIGKRDLMACAQTGSGKTAAFLLPVLSRLYQMGPPKDDLEQQAAQGRFNQRK
+QFPLALVLAPTRELATQIYDEARKFAYRSHVRPCVVYGGADIGAQMRDLSKGCHLLVATP
+GRLVDMMERGKVGVERIRFLVLDEADRMLDMGFEPQIRRIVEKDNMPVTGDRQTLMFSAT
+FPKEIQMLARDFLHDYIFLAVGRVGSTSENITQKVVWVEDNDKRSFLLDLLNASGPDSLT
+LVFVETKKGADSLEYFLYTEGYPAGSIHGDRSQREREDALKTFRSGKTPILVATAVAARG
+LDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNEKNKNIVKDLVSLLMEAH
+QEVPGWLESMCAEQRHSTGSSRRGNNKGRFGSGTFGARDYRQQQTVPSGRGGGRGGPQAG
+GNPGQGAFAAPPPPFFYGGYGGGGGGSYGGAYSAVAPPSGPPAQDWWGGN
+>C_sca_180148_Lottia_gigantea_Pl10
+MGRYDRQGSAPPQQGGSRWDALGDDVPRERKWGHNRWDSRADSGDTWSNNGGEVDWSTPL
+PRNERLEHELFGGGNTGINFDKYEDIPVEASGENPPTNIENFEDASLGEIIRNNIVLSKY
+PKPTPVQKYAIPIVLNKRDLMACAQTGSGKTAAFLVPILNLLYETGPGEAHEAEQRQGQG
+RTYVRRKQYPSALVLAPTRELASQIYDEARKFAYRSRVRPCVVYGGADIGAQMRDLDRGC
+HLLVATPGRLVDLMERGKVELQHCRYLMLDEADRMLDMGFEPQIRRIVEKDSMPPSGKRQ
+TLMFSATFPKEIQILARDFLDNYIFLAVGRVGSTSENITQKVVWVEESEKRSFLLDLINA
+AGPESLTLVFVETKKGADALEVFLTREGFPATSIHGDRSQREREDALRLFRSGDRPILVA
+TAVAARGLDISNVRHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFINEKNKNIVRDLL
+DLLMEANQEVPSWLEAVATESRSSAGSKRGGRKYGAGGFGARDYRQGNKGPKPAMGMGNG
+VKPQMGGYPHMNPFVNSSSSYGGSYGGSYGSSYNNYNQGTDWWSSN
+>e_gw1.100.74.1_Daphnia_pulex_Pl10
+GNARWKESSESDWTTLTAKDDRLELEMFGTGNSGINFDKYEDIPVEATGNDVPAHINTFE
+DVKLTEIIRSNIALTRYDKPTPVQKYAIPIILARRDVMACAQTGSGKTAAFLVPILNQLF
+ERGPVVNQSAGQRSYGRRKQYPLALVLAPTRELATQIYDEAKKFAYRSRVRPCVVYGGAD
+VRQQMQDLERGCHLLVATPGRLVDMLERGKIGLEHCNFLVLDEADRMLDMGFEPQIRRIV
+EQDTMPKTGDRQTLMFSATFPKEIQMLARDFLENYIFLAVGRVGSTSENITQKIVWVEEH
+DKRSFLLDLLNASGLNKFNSQVETESTEHEQLTLVFVETKRGADALEEFLYRDGYPVTSI
+HGDRSQREREDALKRFRSGKTPILVATAVAARGLDIPHVKHVINFDLPSDVEEYVHRIGR
+TGRMGNLGVATSFFNEKNRNLIRDLVELIIETKQELPSWLEGMAMDIKHQSGGVSRRGGG
+GRGGGRFSGGFGSRDYRTSTSGSGGSTRPGGSVGGPRTSGGGSYPNYSAPPPTHGTKQKK
+ETKLLGYTFGLNPSVFFVTFRCCCLLHASLFLLLMRPVRKQQQKKSPKPFHHPLIFSYLY
+WVLWRFIHFFDCLERKNIQRVQGVHFISKRSAPADL
+>mk4.001067.00.01_Schmidtea_mediterranea_Pl10-a
+MAQRNKDSYNDSNRPQWNRGYNVSRNKTQNKYPKDNFDNNERKSNGSYVNNNYEYQVNNN
+QNKWLYQMPFNRHLENELFSHQEPGVNFDDYDDIPILTTGPDFDHDNYQGIFGFEGLKMT
+KIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPG
+DSQIPGNYEKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNLS
+RGCNLLVATPGRLIDMLKRDKIGLQFISIISNRYLVLDEADRMLDMGFEPQLRQIVEDSD
+MPYVGDRQTLMFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHNITQHIFYIEEFRKRN
+HLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKN
+GSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGESVSFFNDNN
+VNVVKGLINVLEEAQQEVPVWLYEKLKDMKHIKQFRNQQKMTPKRYNGFGGRDYRQTFPP
+RDPNPQPFQTKAGYKIIFADDATIYFVLILIAAMFY
+>mk4.000039.11.01_Schmidtea_mediterranea_Pl10-b
+MESHKILQAELVKAQRLNRELHQQIVQLTTEIQRIKSSWVEPKRVKVLYQKMTAAQQGWA
+EEKQLNQNQKTQIRGLEVSACQEGNAVTYPLFSNLTCQESSASKAQTNSNEDAQKYVPPH
+LRNKTKSYSSDNLNNCETRSFGDNRNSQGNWRNGPKATTRGNTRGRGGQHSFDRSNSYQE
+SEWGRNQKDKVNRAISSEINKSYGTQRSFEGPSRSTRFDSDDNFHKSNFSSIAEISWDIQ
+QPANPKLEKELFVGHNSGINFDQYDNIPVNTTGPQWQHDKYTGVTSFSELKLHPIIAHNI
+GLTQYSRPTPVQRYAVPIIVQRRDLMACAQTGSGKTAAFLIPLLNMMYNDGPGNSLSRTG
+YKKEYPVALILAPTRELALQIYEEARKFSYRSLVRPCVVYGGADIRNQLHDLSQGCNMLV
+ATPGRLSDMLERCRIGLDCIRYLVLDEADRMLDMGFEPQIRKIVEQTNMPPPGNRQTLMF
+SATFPKEIQMLASDFLQDYLFLRVGKVGSTSQNITQRIVYVDENEKRDHLLDILADIDSE
+SLILVFVETKRGADALEGFLHGEGFRVASIHGDRSQSDRELALQCFRDGRTPILVATAVA
+ARGLDIPNVKFVINYDLPTDIEEYVHRIGRTGRVGNLGEAISFYTDKNNNVAREL
+>Aqu1.214651_Amphimedon_queenslandica_Pl10
+MIILLTLGRYIPPHLRNKDYIEEDGRKDGPPPSGQRGYDQRDVRSSSYSDHRRGSRGYDD
+RRGGGGYDHRGRDSYDRYRGDSYDRRGEDAYDRRGSYDPRSRDYDSYERRGSDRDFYDRS
+RNDRQYSGSNRDTPSDKPSGGGGGGGYDETDSAPQSVKVSDDKKNDKFHDGDQYDSHRDT
+GGRWAQLDYDRRYSGPRYDDRRSSGRYVERRGSLPVRGFYDRDSTTWGQYSSGYGHGPPS
+QWDRDEWKRPLPSNPRLENELFGGANTGINFDKYEEVKVEATGQDCPKNIENFSDMNFSP
+IIQENIKVPHYSKPTPVQKHSIPMIMNRRDLMSCAQTGSGKTAAFLLPILSLLFEDGPPP
+PPPDPRYASGRRKQYPLSLILAPTRELASQIYDEARKFSYRSRVRPCVVYGGADIGGQIR
+DLEKGCLLLVATPGRLVDMLERGRVGLELCRFLVLDEADRMLDMGFEPQIRRIVEQDRMP
+PCGERQTLMFSATFPKEMQVLARDFLDNYIFLAVGRVGSTSENITQKIVWVDECDKRSFL
+LDILDASADSGALILVFVETKKSCDALDDYLYNQGYRCTCIHGDRSQVQREDALRSFKCA
+ETPILVATAVAARGLDIPNVKHVVNFDLPNDIEEYVHRIGRTGRVGNLGLATSFCNDRNR
+NICSDLLDLLIEARQEVPSWLESMAYEIKAQSKMKQQARRWGGGGGFGGRDYRRSYSQPY
+TGGGGGGYGYHHHGHGGGGGGSSDWWN
+>NP_588033.1_Schizosaccharomyces_pombe
+MSDNVQQQVDSVGSVTEKLQKTNISRPRKYIPPFARDKPSAGAAPAVGDDESVSSRGSSR
+SQTPSEFSSNYGGRREYNRGGHYGGGEGRQNNYRGGREGGYSNGGGYRNNRGFGQWRDGQ
+HVIGARNTLLERQLFGAVADGTKVSTGINFEKYDDIPVEVSGGDIEPVNEFTSPPLNSHL
+LQNIKLSGYTQPTPVQKNSIPIVTSGRDLMACAQTGSGKTAGFLFPILSLAFDKGPAAVP
+VDQDAGMGYRPRKAYPTTLILAPTRELVCQIHEESRKFCYRSWVRPCAVYGGADIRAQIR
+QIDQGCDLLSATPGRLVDLIDRGRISLANIKFLVLDEADRMLDMGFEPQIRHIVEGADMT
+SVEERQTLMFSATFPRDIQLLARDFLKDYVFLSVGRVGSTSENITQKVVHVEDSEKRSYL
+LDILHTLPPEGLTLIFVETKRMADTLTDYLLNSNFPATSIHGDRTQRERERALELFRSGR
+TSIMVATAVASRGLDIPNVTHVINYDLPTDIDDYVHRIGRTGRAGNTGQAVAFFNRNNKG
+IAKELIELLQEANQECPSFLIAMARESSFGGNGRGGRYSGRGGRGGNAYGARDFRRPTNS
+SSGYSSGPSYSGYGGFESRTPHHGNTYNSGSAQSWW
+>XP_960926.2_Neurospora_crassa
+MADQLSSGMGNLSIDQQPPSGPQMGGQGQMRRSYIPPHLRGKMGDAAPPMAGPNGLNNSA
+WAGNNNYDARGPGGGGNWPAPGGPPGPGFEGQQGAGWGGPRPQGGFNPNAYRGNAGAGAG
+AGAGGGGGSFSNRGSGDGQWRDGKHIPGPANPRVERELFGTPDDPSKQHTGINFEKYDDI
+PVEASGDNVPEPVLTFSNPPLDNHLISNIQLARYNVPTPVQKYSIPIVMGGRDLMACAQT
+GSGKTGGFLFPILSQSFHTGPSPIPASAAGAYGRQRKAYPTALILAPTRELVSQIYDEAR
+KFAYRSWVRPCVVYGGADIGSQLRQIERGCDLLVATPGRLVDLIERGRISLCNIKYLVLD
+EADRMLDMGFEPQIRRIVEGEDMPKVNDRQTLMFSATFPRDIQILARDFLKDYIFLSVGR
+VGSTSENITQKVEYVEDIDKRSVLLDILHTHAGGLTLIFVETKRMADSLSDFLINQNFPA
+TSIHGDRTQREPAATAAAAMVVVVPPPVATAVVVVLATAAAVAAAAMVAAVTATLAVPVA
+SLGGKFSSTTFFRSHSMLRTWPTVRSDIIRRFLCGISYRTLFDF
+>XP_964910.1_Neurospora_crassa
+MADHGWGAAPAATEAKAEAGPWGTADLKSALSDTNGHSGPAPVEQAVPPKLEGWVEAEPY
+HYDEFANRETEWDGQARIYEWDGEEGDIGPELPELEDQLFGPVEQRGRRGIDFSAIAELQ
+LVQEGPTRVEPIDSFRAAGLHPAMLRNVELAGYDVPTPIQRYCVPAISQGHDVIAIAQTG
+SGKTAAYMIPIINKLMGKAKKLAAPRPNPVTYQPGIDQPCRAEPLVVVVCPSRELAVQIF
+NEARKFCYRSMLRPCVIYGGGPMREQMEQIAKGCDILVASPGRLIDFMDRPDILSLRRVR
+YMVIDEADEMLHDDWKDELDQILSGGDQEEGNIKYMLFSATFPKAARDLATTHLADNHVR
+LRVGRAGSTHSNIKQDVIWVEPYLKKQACLDLLNTVPPGRTIIFVNSKRAADELDDFLFN
+KGVPCVSMHSDRTQREREAAMRAFRAGRSPVLITTAVTARGIDVRNVLHVINFDLPSTMY
+GGIEEYVHRIGRTGRIGHRGLATSFYTERDEDLASVLTRTLLETGQEVPDFLQQYIPEDT
+QNLHFEADSDFEEDVGGGGDDADGDDAGGGWGGGGGADDAGDNAGGDGWGAGN
+>NP_015206.1_Saccharomyces_cerevisiae
+MADLPQKVSNLSINNKENGGGGGKSSYVPPHLRSRGKPSFERSTPKQEDKVTGGDFFRRA
+GRQTGNNGGFFGFSKERNGGTSANYNRGGSSNYKSSGNRWVNGKHIPGPKNAKLEAELFG
+VHDDPDYHSSGIKFDNYDNIPVDASGKDVPEPILDFSSPPLDELLMENIKLASFTKPTPV
+QKYSIPIVTKGRDLMACAQTGSGKTGGFLFPLFTELFRSGPSPVPEKAQSFYSRKGYPSA
+LVLAPTRELATQIFEEARKFTYRSWVRPCVVYGGAPIGNQMREVDRGCDLLVATPGRLND
+LLERGKVSLANIKYLVLDEADRMLDMGFEPQIRHIVEECDMPSVENRQTLMFSATFPVDI
+QHLARDFLDNYIFLSVGRVGSTSENITQRILYVDDMDKKSALLDLLSAEHKGLTLIFVET
+KRMADQLTDFLIMQNFKATAIHGDRTQAERERALSAFKANVADILVATAVAARGLDIPNV
+THVINYDLPSDIDDYVHRIGRTGRAGNTGVATSFFNSNNQNIVKGLMEILNEANQEVPTF
+LSDLSRQNSRGGRTRGGGGFFNSRNNGSRDYRKHGGNGSFGSTRPRNTGTSNWGSIGGGF
+RNDNEKNGYGNSNASWW
+>XP_716633.1_Candida_albicans
+MSDISKQMNNLSVNDGANTVNNNNSFRGGRSQYVPPHLRNRQGGGNQSGSSSESSDVPFG
+GSQRGGFNSNGFNNNRGGFNNGGYNNNRGGFNNGGFNNRGNYNQSFGGRGGRGGFNNGGG
+RYQRPTPGVGKWQDGKHEPAPRNEKLEVELFGTADDSHFQSSGINFDNYDDIPVEASGDK
+VPEPITSFTAPPLDELLVENIQLSRFTKPTPVQKYSVPIVAAGRDLMACAQTGSGKTGGF
+LFPVLSESYMKGPAPVPESNGAFSSHKVYPTILVMAPTRELVSQIYEESKKFSYRSWVRA
+CVVYGGADIGQQMRNMDRGCDLLVATPGRLKDLLDRGKVSLANIRYLVLDEADRMLDMGF
+EPQIRYIVEECDMPAVKDRQTLMFSATFPRDIQMLARDFLKDYVFLSVGRVGSTSENITQ
+KILYVEDDEKKSVILDLLSANENGLTIVFTETKRMADNLADYLYDQGFPATAIHGDRSQY
+EREKALAAFKNGAAPILVATAVAARGLDIPNVSHVINYDLPSDIDDYVHRIGRTGRAGNV
+GIATAFFNRNNKNVVKGLIELLSEANQEVPDFLTKIAREGAFGKMTRGGGRGGSSRGPSR
+DFRRSGNSGWGNSGNSGWGNSGNASSSGWGGNSSSSYSNTNSNYGGGYNNNQRSNFSSGG
+SYGNQTGSNSWW
+>XP_001645038.1_Vanderwaltozym_olyspora
+MADLQEQVQNLNINDDDKNASSYVPPHLRNQRRGPPRHDSPSDGSENNNDFGFGFNNRRG
+GYNGGSGYRGGNNSYNRRGNYQGGQNNSNNNNNGGGFNRIPGRGSWTNGKHVPGAKNQNL
+EVQLFGTPEDPQFQSSGINFDNYDDIPVDASGTDVPEAITEFTSPPLDALLLENIILARF
+TKPTPVQKYSVPIVSRGRDLMACAQTGSGKTGGFLFPVLSESFKNGPSPMPESARKSFVK
+KAYPTALVLAPTRELATQIYDEAKKFTYRSWVRPTVVYGGSDIGSQIRDLSRGCDLLVAT
+PGRLSDLLERGRVSLANVKYLVLDEADRMLDMGFEPQIRQIVDGCDMPPVGERQTLMFSA
+TFPDDIQHLARDFLSDYIFLSVGKVGSTSENITQRILYVEDMDKKSTLLDLLSASNDGLT
+LIFVETKRMADELTDFLIMQDFRATAIHGDRTQSERERALAAFKNGNANLLVATAVAARG
+LDIPNVTHVVNYDLPSDIDDYVHRIGRTGRAGNTGVATAFFNRGNRNIVKGMYELLAEAN
+QEIPPFLNDVMRESGRGGRTSGFSSRNNSNRDYRRSGSNNGGSWGNSRSNSNSGAGGWGS
+SRSGGAGGAGGAGGAGGAGGSSWGRSGSSGWGNSSSSNAGAGSNAKSSWW
+>XP_448006.1_Candida_glabrata
+MSDGSGRYVPPHIRRGGGNSHESAAADGLSGSRYSGNGFFSSPNRGNHKSSGGFFGSRPF
+NDRRTGQGSRASGSGGFGGSGGRYGWVNGKHVPYPKNPRLEMELFGNATDHVTSGINFDN
+YDDIPVEASGDNVPEAITEFKSPPLDELLLENVELANFSKPTPVQKYSIPIVTKNRDLMA
+CAQTGSGKTGGFLFPVLSELFLNGPAPLPEHTRHSYMRKCYPSALVLAPTRELAIQIFDE
+AKKYTYRSWVKPYVVYGGAPIGQQMRDMDRGCNLLVATPGRLNDLLERGKISLVNVKYLV
+LDEADRMLDMGFEPQIRHIVEDCDMPSVNDRQTLMFSATFPREIQHLARDFLKDYIFLSV
+GRVGSTSENIQQKVLFVEDYDKNSALLDILINEIDGLTLVFVETKRMADQLTDFLIVQNF
+KATAIHGDRTQAERERALHAFRNGIANILVATAVAARGLDIPNVTNVINYDLPTDIDDYV
+HRIGRTGRAGNVGVATSFFNSNSMNIAKELMDLLTEANQEVPQFLVNMVQDSMRFGRGGR
+NSRTGSNRGRGSNTRDYRHSNKDDWGSLGSSRRGFRSNDNRGFGNNWGSSSGDGFTNKAA
+NSWW
+>XP_002547951.1_Candida_tropicalis
+MSEITKQMNDLSVNDAANTNNNQNQNQNQNQNQTGRRQYVPPHLRNRPQQQQSDASDIPF
+GGSRRTGGYNNNGGYNNGGYNNGGYNNGGYNNYNRGGYQNNRGGNYGGRGGRGGYNNAGG
+RYQRPTPGVGRWVEGKHEPAARNEKLELELFGTADDSTFQSSGINFDNYDDIPVEASGDD
+VPEPITAFTAPPLDELLVENITLSRFTKPTPVQKYSVPIVAAGRDLMACAQTGSGKTGGF
+LFPVLSESYLNGPAPVPETTGAFSSHKVYPTILVMAPTRELVSQIYEESKKFSYRSWVRP
+CVVYGGADIGQQMRNLDRGCDLLVATPGRLKDLLERGKVSLANIKYLVLDEADRMLDMGF
+EPQIRHIVEECDMPEVTDRQTLMFSATFPRDIQMLARDFLKDYVFLSVGRVGSTSENITQ
+KILYVEDEDKKSVILDLLAANENGLTIVFTETKRMADQLADFLYDQGFPATAIHGDRSQY
+EREKALAAFKNGAAPILVATAVAARGLDIPNVGHVINFDLPSDIDDYVHRIGRTGRAGNV
+GIATSFFNRGNKNVVKGLIEILSEANQPIPDFLTKVSREAAFGKMSRGGSRGSRGGFRDV
+RRGGNSGGYNSGWGNSNGGWGGNSNAAGNNNWGNSSYSQQSGGSNYGGQRSSSSYGNQTG
+SNSWW
+>XP_448898.1_Candida_glabrata
+MTELAEQVSMPEGQQRRGGYVPPHIRNGGGRRGDSAPRGGFNNGGGRGGFFRNNGDRGGF
+GFGGRGGGFGGNRGGFGGNRGGFGGGMRGRWVDGKHVPGQRNERIELELFGAPEDPSFQS
+SGINFDNYDDIPVEASGEDVPEAITEFTSPPLDSLLLENIKLARFTKPTPVQKYSVPIVS
+KGRDLMACAQTGSGKTGGFLFPVLSESFLTGPAEKAANDGYSYQRKAFPTAVVMAPTREL
+ATQIFDEAKKFCYRSWVKPCVVYGGAPIGNQMREMDHGCDLLVATPGRLNDLLERGKVSL
+SNVKYLVLDEADRMLDMGFEPQIRHIVEDCDMPPTGERQTLMFSATFPHDIQHLARDFLH
+DYIFLSVGRVGSTSENITQRILYVENRDKNSALLDLLAASNDNLTLIFVETKRMADQLTD
+FLIMQNFSATAIHGDRSQAERERALAAFRSGRANILVATAVAARGLDIPNVTHVINYDLP
+SDVDDYVHRIGRTGRAGNTGVATAFFNRDNNNIVKGLYEILEEANQEIPPFLEDCLREVS
+FSRSGSNRSTRGNRSSNTRDYRKHGGNGSFGQNSRNSSWGSARGGGFGGSTGGWGNDRAG
+GSAGGWGASNTKTSSWW
+>NP_014847.1_Saccharomyces_cerevisiae
+MAELSEQVQNLSINDNNENGYVPPHLRGKPRSARNNSSNYNNNNGGYNGGRGGGSFFSNN
+RRGGYGNGGFFGGNNGGSRSNGRSGGRWIDGKHVPAPRNEKAEIAIFGVPEDPNFQSSGI
+NFDNYDDIPVDASGKDVPEPITEFTSPPLDGLLLENIKLARFTKPTPVQKYSVPIVANGR
+DLMACAQTGSGKTGGFLFPVLSESFKTGPSPQPESQGSFYQRKAYPTAVIMAPTRELATQ
+IFDEAKKFTYRSWVKACVVYGGSPIGNQLREIERGCDLLVATPGRLNDLLERGKISLANV
+KYLVLDEADRMLDMGFEPQIRHIVEDCDMTPVGERQTLMFSATFPADIQHLARDFLSDYI
+FLSVGRVGSTSENITQKVLYVENQDKKSALLDLLSASTDGLTLIFVETKRMADQLTDFLI
+MQNFRATAIHGDRTQSERERALAAFRSGAATLLVATAVAARGLDIPNVTHVINYDLPSDV
+DDYVHRIGRTGRAGNTGLATAFFNSENSNIVKGLHEILTEANQEVPSFLKDAMMSAPGSR
+SNSRRGGFGRNNNRDYRKAGGASAGGWGSSRSRDNSFRGGSGWGSDSKSSGWGNSGGSNN
+SSWW
+>XP_002419507.1_Candida_dubliniensis
+MSDINKQMNNLSVNNGANTVNNNNNNGLRGGRSQYVPPHLRNRQGGGNQSGSSSESSDVP
+FGGSQRGGFNSNGFNSRGGFNNGGYNNNRGGYNNGGFNNRGNFNQSFGGRGGRGGFNNGG
+GRYQRPTPGVGKWIDGKHEPAPRNEKLELELFGTVDDSHFQSSGINFDNYDDIPVEATGD
+NVPEAITSFTAPPLDELLVENIQLSRFTKPTPVQKYSVPIVAAGRDLMACAQTGSGKTGG
+FLFPVLSESYMKGPAPVPESNGAFSSHKVYPTTLVMAPTRELVSQIYEESKKFSYRSWVR
+ACVVYGGADIGQQMRNMDRGCDLLVATPGRLKDLLDRGKVSLANIRYLVLDEADRMLDMG
+FEPQIRYIVDECDMPAVKDRQTLMFSATFPRDIQMLARDFLKDYIFLSVGRVGSTSENIT
+QKILYVEDDEKKSVILDLLSANENGLTIVFTETKRMADNLADYLYDQGFPATAIHGDRSQ
+YEREKALAAFKNGAAPILVATAVAARGLDIPNVSHVINYDLPSDIDDYVHRIGRTGRAGN
+VGIATAFFNRNNKNIVKGLVELLSEANQEVPDFLTKVAREGAFGKMGRGGRGGSSRGPSR
+DFRRSGNSGWGNSGNSGWGNSGNSGWGGNSSFSNTNSNGGGYHSNNQRSNFNSSGSYGNQ
+TGANSWW
+>XP_001228973.1_Chaetomium_globosum
+MADQLNGDMGNLSLGSPQPGQHPGQQPTARSYIPPHMRGKMSAPGSPGSPIASPPMNSPP
+QPGPGSSPMGGLNNSAWAGNNNFDARAGGGGNWSGGYENGPGPQPWGGPRGGGGFNRNAY
+RGPNAGGGGGGNMGGGVGRGEGRWIEGKHVIGNSDPRLERDLFGTADDPSKQHTGINFEK
+YDDIPVNPSGRDVPEPVLTFSNPPLDAHLLSNIELARYQIPTPVQKYSIPIVINGRDLMA
+CAQTGSGKTGGFLFPIMHQSFTQGPSPIPAQSGGGYRQRKAYPTALILAPTRELVSQIYE
+EARKFAYRSWVRPCVVYGGADIGSQLRQMERGCDLLVATPGRLVDLIERGRISLCNIKYL
+VLDEADRMLDMGFEPQIRRIVQGEDMPTTGQRQTLMFSATFPRDIQMLAQDFLNDYVFLS
+VGRVGSTSENITQKVEYVEDVDKRSVLLDILHTHAGGLTLIFVETKRMADSLSDFLINQN
+FPATSIHGDRTQRERERALELFRNGKCPILVATAVAARGLDIPNVTHVINYDLPTDVDDY
+VHRIGRTGRAGNTGIATAFFNRGNRGIVRELLDLLKEANQEVPAFLETIARESSFGGGGG
+RGRGGGGRGRGGRGGNTDFRKYGGGGGGFGGGGGGFGGGQHGSGGGGGFGGGGGYGGAPQ
+SGGYGGGYSGGYGGGYGNPGGAGGQSWW
+>XP_002493545.1_Pichia_pastoris
+MSELEDSMNNLNVNEGGRQSKSNYVPPHRRNGQGSSAFANNGSRGGGFGGRGRDNFSAGR
+GGGRNGMNFRGGRGRGPTRGQGRWVQGKHVPAPKDEELELKMFGTPEDPSFQSSGLNFDN
+YDDIPVEATGEDVPEPITQFTSPPLDELLLENIKLSRFTKPTPVQKYSVPIVSNHRDLMA
+CAQTGSGKTGGFLFPVLSECFQTGPAPIEVESETVFRKHRAYPTILVMAPTRELVSQIYD
+EAKKFAYRSWMRPCVVYGGANIRDQMEDLILGCDLLVATPGRLSDLLERGKISLAKIKYL
+ILDEADRMLDMGFEPQIRHIVQGCDMPSVNERHTLMFSATFPRDIQLLAKDFLKDYIFLS
+VGRVGSTSENITQRVLSVEDDEKKSVLLDILSSSDDIKEGLTLIFVETKRMADTLSHFLV
+TRNFPATSIHGDRTQQEREHALHLFKSGAAPILVATAVAARGLDIPNVTHVVNYDLPADI
+DDYVHRIGRTGRAGNVGIATAFVNRGNKNLIKGLIELLTEANQEVPQFLSALSREATMGR
+GGARGGRGGRNAYGKDFRRSSNYPPQPSSQTYGRANGGSGYFGGSNFYGSAPSSNTTQQS
+SGSDWW
+>XP_002844169.1_Arthroderma_otae
+MADNLKIGNLSLNDSQHAPNATGRSAYIPPHLRGQARQAAAAESTSGSTSAEGVDGHAPG
+QNGRPAGMNASAWAPGGPNNAPGWSSGDYAPRGGPAVNGNSGWGQPAGSRRTFDPHAYGH
+PGHQGQQGGNYGGAARGSGDGQWRDGKHIPGPSNARLERELFGVPNDPSKQHTGINFANY
+DDIPVEASGQNVPEPVSTFTNPPLDDHLISNIKLASYKVPTPVQKYSIPIVMGGRDLMAC
+AQTGSGKTGGFLFPILSQAFQNGPSPAPTQQGGQFSYGRQRKAYPTSLILAPTRELVSQI
+YDEARKFAYRSWVRPCVVYGGADIGSQLRQIERGCDLLVATPGRLVDLIERGRISLCNIK
+YLVLDEADRMLDMGFEPQIRRIVEGEDMPPVAGRQTLMFSATFPRDIQMLARDFLKDYVF
+LSVGRVGSTSENITQKVEYVEDADKRSVLLDILHTHGAGLTLIFVETKRMADSLSEFLIN
+QHFPATAIHGDRTQRERERALEYFRNGRCPILVATAVAARGLDIPNVTHVVNYDLPTDID
+DYVHRIGRTGRAGNTGISTAFFNRGNRGVVRDLIELLKEAHQEVPSFLENIAREGSGYGG
+RGGRGRGRGSAGANRDMRRMGGGMGGPPSYGGGGGGGGGGNYTAPPSYGGGNYGGAPYGG
+GYGGGGYGNPSGPTGPSSWW
+>XP_001526175.1_Lodderomyces_elongisporus
+MSDISQQMNNLSVQDNNKPNGNGYSGQPQQQSGRRQYVPPHLRNRSSHQPSSNGANGDIP
+FGGSRRSDYGGGRGGFGFGGGSNGGGSGPSGGYRNGGARGGSRGGFGGGRYQRPTPGVGR
+WVDGKHEPAPRNDRLELELFGVAEDTLFQSSGINFDNYDDIPVEASGEGVPEPINSFTAP
+PLDELLVENIKLSRFTKPTPVQKYSVPIVAAGRDLMACAQTGSGKTGGFLFPVLSESYMN
+GPAPIPESTGAFSSHKVYPTILVMAPTRELVSQIYDESKKFAYRSWVRPCVVYGGADIGN
+QIRQLDRGCDLLVATPGRLKDLLERGRVSLANIKYLVLDEADRMLDMGFEPQIRHIVQEC
+DMPDVQDRQTLMFSATFPRDIQMLARDFLKDYIFLSVGRVGSTSENITQKVLYVEDEEKK
+SVILDLLNANSEGLTIVFTETKRMADNLADFLYDQGFPATAIHGDRSQYEREKALAAFKS
+GQAPILVATAVAARGLDIPNVSHVINYDLPSDIDDYVHRIGRTGRAGNVGIATAFFNRNN
+KNIVKGMLDLLTEANQEVPDFLNKIARESAFGRPGRGSSRGGGAGGFGGSRGGANRDFRR
+AGGASGSSSSGWGNSSSSGWGGSGNSGWGNSNGYSNGGGSYGGSRSSFNDNSSYGNPSSQ
+NSWW
+>XP_001550389.1_Botryotinia_fuckeliana
+MADQLNMNGLNLNGGEPRSYIPPHMRGKMGGPAPAGPPANLNGSAWAPQGNGYANGPRPA
+GGDSWANAPDFTPRGNGAPRGGNNWNPSGPPSFNKNAYGNPAAGAGGPGGAGGAGGAGGG
+AGQARGGGDGQWRDGKHIAGPANARVERELFGIADDPTKQQTGINFEKYDDIPVEASGQD
+VPEPVLKFTNPPLDDHLIKNIELAHYKVPTPVQKYSIPIVMGGRDLMACAQTGSGKTGGF
+LFPILSQAFQTGPSPVPANAAGSFGRTRKAYPTSLILAPTRELVSQIYDESRKFAYRSWV
+RPCVVYGGADIGSQLRQMERGCDLLVATPGRLVDLIERGRISLQNIKYLVLDEADRMLDM
+GFEPQIRRIVEGEDMPGVQNRQTLMFSATFPRDIQMLARDFLKDYVFLSVGRVGSTSENI
+TQKVEYVEDIDKRSVLLDILHTHGAGLTLIFVETKRMADSLSDFLINQNFPATSIHGDRT
+QRERERALEMFRNGRCPILVATAVAARGLDIPNVKHVVNYDLPTDIDDYVHRIGRTGRAG
+NTGISTAFFNRGNRGVCRDLIELLKEANQEIPSFLENIAREGGGFGGGRGGRSGGRGRGG
+GANRDFRKFGGGGGGGFNGGGGFGGPPASGGYGGGGGGFGGPPAPSSYGPPPGQYGGGGG
+GYGGGNGGGYGNPSAGGGGQSWW
+>XP_002584070.1_Uncinocarpus_reesii
+MAESLKMAGLSLEDSQHAPNHATGRAPYIPPHLRGQQQRGPVPMDGPAPQARAPMPSGSF
+AANGAPNNWAPRGANVNGAPGWNAGSAPRFDPNAYGHPGPRGGQNYGGAGSAPSAGAARG
+SGDGQWRDGKHVPGPANARLERELFGVPNDPTKQHTGINFANYDDIPVEASGHDVPEPVT
+TFTNPPLDDHLISNIKLASYKTPTPVQKYSIPIVMGGRDLMACAQTGSGKTGGFLFPILS
+QAFKNGPSAVPTQNANQFSYGRQRKAYPTSLILAPTRELVSQIYDEARKFAYRSWVRPCV
+VYGGADIGSQLRQIERGCDLLVATPGRLVDLIERGRISLCNIKYLVLDEADRMLDMGFEP
+QIRRIVEGEDMPPVNGRQTLMFSATFPRDIQMLARDFLKDYVFLSVGRVGSTSENITQKV
+EYVEDNDKRSVLLDILHTHGTGLTLIFVETKRMADSLSEFLINQNFPATAIHGDRTQRER
+ERALEYFRNARCPILVATAVAARGLDIPNVTHVVNYDLPTDIDDYVHRIGRTGRAGNTGL
+STAFFNRGNRGVVRDLIELLKEAHQEVPAFLENIAREGSGYGGRGGGRGGGRGRGSNTRD
+MRRMGGGAPPSMGSAPSYGGSYGGGTNNYSSGGSFGGAPSYGGGYSGGGGSYGGGSYGNP
+SGPTGPSSWW
+>XP_752059.1_Aspergillus_fumigatus
+MADSLKMGNLSLNESQHAPAAPPSNGRAAYIPPHLRQRTMGANVDGAAASPPGPAPGAGA
+WNGPRNAPRGGNWANANASDFSPRGPNVPNGNISWTPTETQRRPFNPHAYGHPGHGGSYG
+GSHGSAKGSGDGQWRDGKHIPGPANARLERELFGVPNDPTKQSTGINFANYDDIPVEASG
+HDVPEPVNAFTNPPLDDHLISNIKLARYQTPTPVQKYSIPIVMNGRDLMACAQTGSGKTG
+GFLFPILSQAFQTGPSPVPAQASGQFGYGRQRKAYPTSLILAPTRELVSQIFDEARKFAY
+RSWVRPCVVYGGADIGSQLRQIERGCDLLVATPGRLVDLIERGRISLVNIKYLVLDEADR
+MLDMGFEPQIRRIVEGEDMPNVNERQTLMFSATFPRDIQMLARDFLKDYVFLSVGRVGST
+SENITQKVEYVEDHDKRSVLLDILHTHGTSGLTLIFVETKRMADALSDFLLNQRFPATAI
+HGDRTQRERERALEMFRSGRCPILVATAVAARGLDIPNVTHVINYDLPTDIDDYVHRIGR
+TGRAGNTGIATAFFNRSNRGVVRELIDLLKEAHQEVPSFLESIAREGSGYGGRGGRGGRG
+RGGNATRDMRRMGGNVGGGGPSFGGGYGAPSGSSYGGGAGGYGAPPAYGGGYGGGYGGGS
+YGNPSGPTGPSSWW
+>XP_458265.1_Debaryomyces_hansenii
+MADITQQMNNLSVEQGSQGNGSSRSQYVPPHLRNRPSGGNGSFGGNRRGGFNNNSFGGFD
+NNRRGGYNNNSFGGYNNNRRGGFNNARGSGRYNTPKPGVGRWVDGKHEPAEKNERLEKEL
+YGIDEEPTTQSSGINFDNYDDIPVEASGEGVPEPITAFTAPPLDPLLVENVKLSRFTKPT
+PVQKYSVPIVAAGRDLMACAQTGSGKTGGFLFPVLSESYMNGPAEVPETAGAFSSHKVYP
+TALVMAPTRELVSQIFDEAKKFAYRSWVRPSVVYGGADIGGQIRNLERGCDLLVATPGRL
+KDLLERGRVSLASIKYLVLDEADRMLDMGFEPQIRHIVQECDMPGVEDRQTLMFSATFPK
+EIQFLARDFLKEYIFLSVGRVGSTSENITQKILYVEDEEKKSVLLDLLSANDNGLTIIFT
+ETKRMADNLADFLYDQGFPATAIHGDRSQYEREKALAAFKTGTAPILVATAVAARGLDIP
+NVSHIVNYDLPSDIDDYVHRIGRTGRAGNIGIATAFFNRNNKNIVKGLVDLLTEANQEIP
+DFLNKIARESAFGGKSMRGGSSRGGRGGATRDFRKQGGSYGGGASSSNWGGSSSSGGGWG
+SSNNGGYSGYSGRSNGSSSYGNPSASNSWW
+>NP_983823.1_Ashbya_gossypii
+MSELVNKMENLSVGDSAQKKSAYVPPHVKRRMKEGGSEPSSRNTENFGNGGRFGGSEHNG
+FGGGRGSWFGGNARGGGPRSSDRGGSSRFGKWVDGKHVPMKRNEKLEVQLFGTPEDPNFQ
+SSGINFDNYDDIPVDASGEDVPDPITEFTSPPLDELLLENIKLARFTKPTPVQKYSVPIV
+AKGRDLMACAQTGSGKTGGFLFPVLSQSFSNGPASTPDESGYYMRKAYPTAVVLAPTREL
+ATQIFDEAKKFTYRSWVKPCVVYGGADIRQQIRELERGCDLIVATPGRLNDLLERGKISL
+CSVKYLVLDEADRMLDMGFEPQIRHIVEGCDMPTVENRQTLMFSATFPTDIQHLAADFLK
+DYIFLSVGRVGSTSENITQKVLHVEDIDKRSVLLDLLAASDGGLTLVFVETKRMADALTD
+FLIMQNLSATAIHGDRTQAERERALAFFRTGRANVLVATAVAARGLDIPNVTHVINYDLP
+SDIDDYVHRIGRTGRAGNTGLATAFFNRGNKNVVKELVDILEEANQEVPSFLSQIAKEMS
+YGGGGGKSSRGGRGGYSRGNSTRDFRRHGGGGGSEWSSANRASSGWGNATRTGSGWGDSS
+GFGGSTESWSNASKTVGSNNSWW
+>XP_001271659.1_Aspergillus_clavatus
+MADGLNMGNLSLNDSQHAPAGPGNTGRAAYIPPHLRGRAGGANVDAAAAAAPPPGPAAWN
+GPRQGAPPRGGNWANANASDFSPRAPSGPNGNNSWTPSEGQRRPFDPHAYGHPGHGGSYG
+GSQGASTRGSGDGQWRDGKHIPGPANARLERELFGVPNDPTKQSTGINFANYDDIPVEAS
+GQDVPEPVNAFTNPPLDDHLISNIKLARYQTPTPVQKYSIPIVMNGRDLMACAQTGSGKT
+GGFLFPILSQAFQKGPSAVPAQASGQMSYGRQRKAYPTSLILAPTRELVSQIFDEARKFA
+YRSWVRPCVVYGGADIGSQLRQIERGCDLLVATPGRLVDLIERGRISLVNINYLVLDEAD
+RMLDMGFEPQIRRIVEGEDMPSVNERQTLMFSATFPRDIQMLARDFLKDYVFLSVGRVGS
+TSENITQKVEYVEDVDKRSVLLDILHTHGTSGLTLIFVETKRMADALSDFLINQRFPATA
+IHGDRTQRERERALEMFRSARCPILVATAVAARGLDIPNVTHVINYDLPTDIDDYVHRIG
+RTGRAGNTGIATAFFNRGNRGVVRELIDLLKEAHQEVPSFLESIAREGSGYGGRGGRGGR
+GRGGNANRDVRRMGGAMGGGAPSFGGGSYGGPGGSYGGGSYGGGAAAPSYGGGYGGASGG
+GGSYGGSYGNPSGPTGPSSWW
+>XP_001482601.1_Meyerozyma_guilliermondii
+MSRAVITDHVRISFFTYKNQRRTNFFSPTMSDITHKMNELSVGDGANRASGAAAGGETPS
+GSSGRSQYVPPHLRNRPNGGSTPSRRGDFGSRSNGFGSGRRGDFNSSGFQFGSGRRGNSG
+FGGRGGFGGGSGRYNSPKPGVGQWVDGKHEPAAPNERLEKELFGVAEDPSVQSSGINFDN
+YDDIPVEATGDGVPEPILAFTAPPLDPLIVENIKLSRFTKPTPVQKYSVPIVASGRDLMA
+CAQTGSGKTGGFLFPVLSESYMNGPDAVPESQGAFSSHKVHPTALVMAPTRELVSQIFEE
+AKKFSYRSWVRPCVVYGGADIGTQIRNLDRGCDLLVATPGRLKDLLERGRVSLSNIKYLV
+LDEADRMLDMGFEPQIRHIVQECDMPGVESRQTLMFSATFPRDIQMLARDFLKDYIFLSV
+GRVGSTSENITQKVLYVEDDEKKSVLLDLLSANDNGLTIIFTETKRMADNLADFLYDQGF
+PATAIHGDRSQYEREKALAAFKSGTAPILVATAVAARGLDIPNVSHVVNYDLPGDIDDYV
+HRIGRTGRAGNVGIATAFFNRNNRNVVKGMIELLSEANQEVPDFLQKISREGSYGSKGGF
+GSMRGGAGRGVLGGGSRGGSRDFRRSGGGFGSSGSSGSNWGSSSSGNGGYRSSSNYGNPS
+SGNSWW
+>XP_001933275.1_Pyrenophora_tritici-repentis
+MAEQLDMGRLNINDSQHNPQNGFNGERSAYIPPHLRGRPQGGPGGPGPAPMDGPPPMMNG
+GGGLGGSAWGPAGHGPPPMNGAGGQGGGWANAPNFTPRGRDGPQGGGGWGGAPRGNFDPN
+AYGKPGGGGSGGARGSGDGAWKDGKHVPGPPNQRVERDLFGVPNDPSKQQTGINFEKYDD
+IPVEASGQGVPEPVTRFTNPPLDDHLLSNIELSGYKVPTPVQKYSIPIVMGGRDLMACAQ
+TGSGKTGGFLFPILAQAFQNGPSPPPQQAQGGYGRQRKAYPTSLVLAPTRELVSQIFDEA
+RKFAYRSWVRPCVVYGGADIGSQLRQIERGCDLLVATPGRLVDLIERGRISLASIKYLVL
+DEADRMLDMGFEPQIRRIVEGEDMPPTAGRQTLMFSATFPRDIQMLARDFLKDYIFLSVG
+RVGSTSENITQKIEYVEDVDKRSVLLDILHTHGAGLSLIFVETKRMADSLSDFLINQGFP
+ATSIHGDRTQREREKALEMFRTGRCPILVATAVAARGLDIPNVTHVVNYDLPTDIDDYVH
+RIGRTGRAGNTGIATAFFNRGNRGVVRDLLELLKEANQEVPGFLESIAREGSGFGGGRGG
+RGGGRGRGNAATRDVRRMGGGGGGFGGGGGGQWGGAPSGGYGGGYGGAPSGGYAPPAPGG
+YSGGGGGGGFGGGYGNPSGPGGNSWW
+>NP_077726.1_Homo_sapiens
+MGDEDWEAEINPHMSSYVPIFEKDRYSGENGDNFNRTPASSSEMDDGPSRRDHFMKSGFA
+SGRNFGNRDAGECNKRDNTSTMGGFGVGKSFGNRGFSNSRFEDGDSSGFWRESSNDCEDN
+PTRNRGFSKRGGYRDGNNSEASGPYRRGGRGSFRGCRGGFGLGSPNNDLDPDECMQRTGG
+LFGSRRPVLSGTGNGDTSQSRSGSGSERGGYKGLNEEVITGSGKNSWKSEAEGGESSDTQ
+GPKVTYIPPPPPEDEDSIFAHYQTGINFDKYDTILVEVSGHDAPPAILTFEEANLCQTLN
+NNIAKAGYTKLTPVQKYSIPIILAGRDLMACAQTGSGKTAAFLLPILAHMMHDGITASRF
+KELQEPECIIVAPTRELVNQIYLEARKFSFGTCVRAVVIYGGTQLGHSIRQIVQGCNILC
+ATPGRLMDIIGKEKIGLKQIKYLVLDEADRMLDMGFGPEMKKLISCPGMPSKEQRQTLMF
+SATFPEEIQRLAAEFLKSNYLFVAVGQVGGACRDVQQTVLQVGQFSKREKLVEILRNIGD
+ERTMVFVETKKKADFIATFLCQEKISTTSIHGDREQREREQALGDFRFGKCPVLVATSVA
+ARGLDIENVQHVINFDLPSTIDEYVHRIGRTGRCGNTGRAISFFDLESDNHLAQPLVKVL
+TDAQQDVPAWLEEIAFSTYIPGFSGSTRGNVFASVDTRKGKSTLNTAGFSSSQAPNPVDD
+ESWD
+>NP_001139357.1_Mus_musculus
+MGDEDWEAEILKPHVSSYVPVFEKDKYSSGANGDTFNRTSASSEMEDGPSGRDDFMRSGF
+PSGRSLGSRDIGESSKKENTSTTGGFGRGKGFGNRGFLNNKFEEGDSSGFWKESNNDCED
+NQTRSRGFSKRGGCQDGNDSEASGPFRRGGRGSFRGCRGGFGLGRPNSESDQDQGTQRGG
+GLFGSRKPAASDSGNGDTYQSRSGSGRGGYKGLNEEVVTGSGKNSWKSETEGGESSDSQG
+PKVTYIPPPPPEDEDSIFAHYQTGINFDKYDTILVEVSGHDAPPAILTFEEANLCQTLNN
+NIAKAGYTKLTPVQKYSIPIVLAGRDLMACAQTGSGKTAAFLLPILAHMMRDGITASRFK
+ELQEPECIIVAPTRELINQIYLEARKFSFGTCVRAVVIYGGTQFGHSVRQIVQGCNILCA
+TPGRLMDIIGKEKIGLKQVKYLVLDEADRMLDMGFGPEMKKLISCPGMPSKEQRQTLLFS
+ATFPEEIQRLAGDFLKSSYLFVAVGQVGGACRDVQQTILQVGQYSKREKLVEILRNIGDE
+RTMVFVETKKKADFIATFLCQEKISTTSIHGDREQREREQALGDFRCGKCPVLVATSVAA
+RGLDIENVQHVINFDLPSTIDEYVHRIGRTGRCGNTGRAISFFDTDSDNHLAQPLVKVLS
+DAQQDVPAWLEEIAFSTYVPPSFSSSTRGGAVFASVDTRKNYQGKHTLNTAGISSSQAPN
+PVDDESWD
+>NP_990039.1_Gallus_gallus_vasa
+MEEDWDTELEQEAAAASQGRSEEQAWMANSGRPNSPSLRFSSRPSSPLSGFPGRPNSPFF
+GFSQNKGSLGANEGLNRSLPVQHDIGGYSGSRESVVRQNREDQPVTRFGRGRSSGSRDFQ
+ERNSANDPGMQDQGFRRVPGIFGQSKCFNSEERNSPLRGSPFAPGGRGAVGGPAGVLKGR
+SEEIDSGRGPKVTYVPPPPPEDEQSIFACYQSGINFDKYDECAVEMSGLDPPAPLLAFEE
+ANFAQTLRKNISKTGYSKLTPVQKHSIPVIQAGRDLMSCAQTGSGKTAAFLLPIVDRMMK
+DGVTASFPKQQDPQCIIVAPTRELINQIFLEARKFVYGTCIRPVVIYGGTQTGHSIRQIM
+QGCNILCATPGRLLDIIEKGKISLVEVKYLVLDEADRMLDMGFGLDMKKLISYPEMPSKD
+RRQTLMFSATFPEEVQRLAGEFLKTDYIFLVIGNTCGACSDVQQNILQVPRLSKRDKLIE
+ILQSTGGERTMVFVDTKKKADYLAAFLCQENLPSTSIHGDREQREREIALRDFRSGKCQI
+LVATSVASRGLDIENVQHVINFDLPNTIEDYVHRIGRTGRCGNTGKAVSFFDDQSDGHLV
+QSLLKVLSRTQQEFQFGGRMAVQRTNIVASTWCPKGLMQAVAEWNPREMRMSYSETTFKS
+WE
+>NP_001016823.1_Xenopus_tropicalis_vasa
+MEENWDTEISTEKPTYIPNFSSLETDNTDNYTAYSNNDITNQNYQSERSFGNRGGYRSER
+GGPTNFNRGSRIGRGRGFDSNRNDQYSDSSERDGYNANEDTQKPFRGRGDWNNSGEGEER
+PRGFGRGGFNNFDSDTGGRGHRGGRGGRGGYKGRNEEVGVESGKNQEEGTEKEVKKVIYV
+PLPPSDSEDDIFRHYQSGINFDKYDEILVDVTGKDVPPAILTFEEANFCETLSRNVTKAG
+YVKLTPVQKHSIPIILAGRDLMACAQTGSGKTAAFLLPILSHMMNEGITASQFLPLQEPQ
+AIIIAPTRELINQIYLDARKFSYGTCVRPVVVYGGIHPVHAMRDVERGCNILCATPGRLM
+DIIGREKIGLSKLKYLVLDEADRMLDMGFAPVMENLIGSPGMPAKEERQTLMFSATYPAE
+IQRLASKFLKSDHLFVVVGLVGGACSDVEQTILEIQEYRKRDKLVEILQSSGNERTMIFV
+NTKKKADVIAGYLCQEHFPTTSIHGDREQCQREEAIRDFRSGKCPVIVCTAVAARGLDIE
+NVQHVINYDVPKEIDEYVHRIGRTGRCGNVGKATSFFNVNEDHVVARPLVKILTDAHQEV
+PAWLEEIAFGGHGALNSLYAADSMGGEAGEKYVSAPSSAQEEEASWD
+>NP_571132.1_Danio_rerio
+MDDWEEDQSPVVSCSSGFGLGSNGSDGGFKSFYTGGAGNDKSNSEGTEGSSWKMTGDSFR
+GRGGRGGSRGGRGGFSGFKSEIDENGSDGGWNGGESRGRGRGGFRGGFRSGSRDENDENR
+NDDGWKGGESRGRGRGGFGGSFRGGFRDGGNEDTGRRGFGRENNENGNDEGGEGRGRGRG
+GFRGGFRDGGGDESGKRGFGRGGFRGRNEEVFSKVTTADKLDQEGSENAGPKVVYVPPPP
+PEEESSIFSHYATGINFDKYDDILVDVSGSNPPKAIMTFEEAGLCDSLSKNVSKSGYVKP
+TPVQKHGIPIISAGRDLMACAQTGSGKTAAFLLPILQRFMTDGVAASKFSEIQEPEAIIV
+APTRELINQIYLEARKFAYGTCVRPVVVYGGINTGYTIREVLKGCNVLCATPGRLHDLIG
+RGKIGLSKVRYLVLDEADRMLDMGFEPEMRKLVASPGMPSKEERQTLMFSATYPEDIQRM
+AADFLKVDYIFLAVGVVGGACSDVEQTVVQVDQYSKRDQLLELLRATGNERTMVFVETKR
+SADFIATFLCQEKISTTSIHGDREQREREKALSDFRLGHCPVLVATSVAARGLDIEQVQH
+VVNFDMPSSIDEYVHRIGRTGRCGNTGRAVSFFNPESDTPLARSLVKVLSGAQQVVPKWL
+EEVAFSAHGTTGFNPRGKVFASTDSRKGGSFKSDEPPPSQTSAPSAAAAADDEEWE
+>NP_001027593.1_Ciona_intestinalis_vasa
+MFDDDWEPAPLTALGNTDFRGASSFDNPYSKKDDGGFGSGFGDSRGGARSKGCFKCGEEG
+HMSRECPQNTGSGFGDSRGGARSKGCFKCGEEGHMSRECPQNTGSGFGDSRGGARSKGCF
+KCGEEGHMSRECPQNTGSGGDHAAQEYHKAGDGDKPRPPLYIPPPPPEDEVEMFASMQRG
+INFGKYDAIPVEVSGLNAPKCISTFEMANLQETILVNVQKAGYDRPTPVQKYSIPIINAD
+RDLMACAQTGSGKTAAFLLPVLTKLVESGVKSSEFSEKKTPQAIIIGPTRELVNQIFLEA
+RKFSRSTIIHPVVVYGGTSVGYQIRAVQKGCDVLIATPGRLMDFINRGLIGLENVRFIIL
+DEADRMLDMGFESEIRKLVSLPGMPQKNNRHTLMFSATFPDEIQKLAHDFLREDFLFLTV
+GRVGGACSDVTQTVISVEWKDKRSKLLELIADVNETKSRTLVFVETKRGADFLACVLCQE
+DFPTTSIHGDRLQQDREQALRDFKLAVCPILVATSVAARGLDIPKVEHVINYDMPREIDE
+YVHRIGRTGRCGNLGRATTFFDNKKDANLARSLVKILSEAQQEVPGWLGECAESAVGSNF
+GAEKGRFGGKDLRERGGEGITGFGSMGGGSGARSTADYDYNDGGGFDCVGVNDDDDSWD
+>XP_002601125.1_Branchiostoma_floridae_vasa
+MACAQTGSGKTAAFLLPVLTGMMKEGLAGSSFSNIQEPQAICVAPTRELAIQIFSEARKF
+SYGTMLRPCIAYGGVSVMHHKSQIQRGCHLLVATPGRLLDFIDKGVISIKKLKYLILDEA
+DRMLDMGFEPEIRRLVETASWGMPAKGERQTLMFSATFPEEIQKLAQDFLEDYIFLTIGR
+VGGANTDVEQTVMESSQYDKREKLTDILGNLGQERVLVFVETKRNADFLASYLSQSGFPT
+TSIHGDRLQKEREEALMDFRTGRAPVLVATSVAARGLDIPKVMVVVNYDLPSSIDEYVHR
+IGRTGRVGNTGKAISFYDSDKDASLARSLVKVLADAQQNVPDWLEDAAEGAIGTNYGPAG
+GAFGARDTRR
+>NP_001139665.1_Strongylocentrotus_purpuratus
+MSEDWGASSVSGGSSFGKSSFGGSSGGVKDDGFGVGVGRGRGRGRGFSPFASNGGVGGMT
+NGTTNGGGESSGGWDESPSKSGSSSSPWGGDGDNGFGKSSFGSKSFGGRGGGGGGGGRGA
+ESGGGRGGGGFGGRREGGGGGGGGACYKCQEEGHMARDCPNGDSSGGGRGGGDRSCYNCG