Anonymous avatar Anonymous committed 8d2a9b5

Import from CVS: tag r19-15prefinal

Comments (0)

Files changed (100)

 (3) By hand.  Do
     cat info/xemacs* | more "+/^File: xemacs.info,  Node: Bugs,"
 
+
+Part II of the XEmacs FAQ, available in a manner similar to the above,
+or via the world wide web, contains extensive information on how to
+track down and report bugs.
+
+	http://www.xemacs.org/faq/
 							-*- indented-text -*-
+to 19.15
+-- W3-3.0.74
+-- Documentation updates
+-- miscellaneous bug fixes
+-- cc-mode-4.388
+-- Custom-1.67
+-- Gnus-5.4.37
+
 to 19.15 beta104
 -- EFS fixes courtesy of Michael Sperber
 -- time.el-1.6
+-*- mode:outline; minor-mode:outl-mouse -*-
 This file describes various problems that have been encountered
 in compiling, installing and running XEmacs.
 
 
 This problem will not happen if the m-...h file for your type
 of machine defines NO_UNION_TYPE.  That is the recommended setting now.
+
+* On Irix 5.x and 6.x, the dumped XEmacs (xemacs) core dumps when executed 
+  on another machine, or after newer SGI IRIX patches have been installed.
+
+The xemacs binary must be executed with the same "libc.so" file which was used 
+when the xemacs binary was dumped.  Some SGI IRIX patches updates this file.
+Make sure that all machines using the xemacs binary are using the same
+set of IRIX patches.  If xemacs core dumps after a patch upgrade then you 
+will have to redump it from temacs.
 report bugs.  (The file `BUGS' in this directory explains how you can
 find and read that section using the Info files that come with
 XEmacs.)  See `etc/MAILINGLISTS' for more information on mailing lists
-relating to XEmacs and other GNU products.
+relating to XEmacs and other GNU products.  You should also read part
+II of the XEmacs FAQ, the latest version of which is available on the
+World Wide Web at:
+	http://www.xemacs.org/faq/
 
 The file `configure' is a shell script to acclimate XEmacs to the
 oddities of your processor and operating system.  It will create a
 native_sound_lib=''
 # make normal error-checking be the default in alpha and beta versions, so
 # that bugs get noticed.  Change this for released versions.
-error_check_default='yes'
+error_check_default='no'
 error_check_extents=$error_check_default
 error_check_typecheck=$error_check_default
 error_check_bufpos=$error_check_default
 Debugging options:
 
 --debug			Compile with support for debugging XEmacs.
-			(Causes code-size increase but no loss of speed.)
+			(Causes code-size increase and little loss of speed.)
 --error-checking=TYPE[,TYPE]...
 			Compile with internal error-checking added.
 			Causes noticeable loss of speed.  Valid types
 native_sound_lib=''
 # make normal error-checking be the default in alpha and beta versions, so
 # that bugs get noticed.  Change this for released versions.
-error_check_default='yes'
+error_check_default='no'
 error_check_extents=$error_check_default
 error_check_typecheck=$error_check_default
 error_check_bufpos=$error_check_default
 Debugging options:
 
 --debug			Compile with support for debugging XEmacs.
-			(Causes code-size increase but no loss of speed.)
+			(Causes code-size increase and little loss of speed.)
 --error-checking=TYPE[,TYPE]...
 			Compile with internal error-checking added.
 			Causes noticeable loss of speed.  Valid types

etc/BETA

-				-*- mode:outline; minor-mode:outl-mouse -*-
-
-* Introduction
-==============
-
-You are running an experimental version of XEmacs.  Please do not
-report problems with Beta XEmacs to comp.emacs.xemacs.  Report them to
-xemacs-beta@xemacs.org.
-
-** XEmacs Beta Mailing List
-===========================
-
-*** Subscribing
----------------
-
-If you are not subscribed to the XEmacs beta list you should be.  Send
-an email message with a subject of `subscribe' (without the quotes) to
-xemacs-beta-request@xemacs.org and follow the directions.  You do not
-have to fill out the survey if you don't want to.
-
-*** Unsubscribing
------------------
-
-To unsubscribe from the list send an email message with a subject of
-`unsubscribe' (without the quotes) to xemacs-beta-request@xemacs.org.
-
-*** Administrivia
------------------
-
-The XEmacs beta list is managed by the SmartList mailing list package,
-and the usual SmartList commands work.  Do not send mailing list
-requests to the main address (xemacs-beta@xemacs.org), always send
-them to xemacs-beta-request@xemacs.org.  If you have problems with the
-list itself, they should be brought to the attention of the Mailing
-List manager Chuck Thompson <cthomp@xemacs.org>.
-
-
-** Beta Release Schedule
-========================
-
-The URL ftp://ftp.xemacs.org/pub/beta/README always contains the best
-estimate of when the next beta XEmacs will be released.  For weekend
-betas the release time is generally in the vicinity of 2PM to 5PM US
-Pacific Time (Universal Time minus 8 hours).  For weekday betas, the
-release time is generally in the vicinity of 8PM to Midnight US
-Pacific Time on the listed day.
-
-While 19.15 and 20.x are in parallel development, a simultaneous
-release day implies a release of 20.x first, followed a few hours
-later by 19.15.
-
-Betas are nominally a week apart, scheduled on every Saturday.
-Midweek releases are made when a serious enough problem warrants it.
-
-
-** Reporting Problems
-=====================
-
-The best way to get problems fixed in XEmacs is to submit good problem
-reports.  Since this is beta software problems are certain to exist.
-Please read through all of part II of the XEmacs FAQ for an overview
-of problem reporting.  Other items which are most important are:
-
-1.  Do not submit C stack backtraces without line numbers.  Since it
-    is possible to compile optimized with debug information with GCC
-    it is never a good idea to compile XEmacs without the -g flag.
-    XEmacs runs on a variety of platforms, and often it is not
-    possible to recreate problems which afflict a specific platform.
-    The line numbers in the C stack backtrace help isolate where the
-    problem is actually occurring.
- 
-2.  Attempt to recreate the problem starting with an invocation of
-    XEmacs with `xemacs -q -no-site-file'.  Quite often problems are
-    due to package interdependencies, and the like.  An actual bug in
-    XEmacs should be reproducible in a default configuration without
-    loading any special packages (or the one or two specific packages
-    that cause the bug to appear).
-
-3.  A picture can be worth a thousand words.  When reporting an
-    unusual display, it is generally best to capture the problem in a
-    screen dump and include that with the problem report.  The easiest
-    way to get a screen dump is to use the xv program and its grab
-    function.  Save the image as a GIF to keep bandwidth requirements
-    down without loss of information.  MIME is the preferred method
-    for making the image attachments.
-
-* Compiling Beta XEmacs
-=======================
-
-** Building an XEmacs from patches
-==================================
-
-All beta releases of XEmacs are included with patches from the
-previous version in an attempt to keep bandwidth requirements down.
-Patches should be applied with the GNU patch program in something like
-the following.  Let's say you're upgrading XEmacs 20.4-beta10 to
-XEmacs 20.4-beta11 and you have a full unmodified XEmacs 20.4-beta10
-source tree to work with.  Cd to the top level directory and issue the
-shell command:
-
-$ gunzip -c /tmp/xemacs-20.4-b10-20.4-b11.patch.gz | patch -p1
-
-After patching check to see that no patches were missed by doing
-$ find . -name \*.rej -print
-
-Any rejections should be treated as serious problems to be resolved
-before starting compilation.
-
-After seeing that there were no rejections, issue the command
-
-$ make all-elc
-
-and go play minesweep for awhile on an older XEmacs while the binary
-is rebuilt.
-
-** Building an XEmacs from a full distribution
-==============================================
-
-Locate a convenient place where you have at least 100MB of free space
-and issue the command
-
-$ gunzip -c /tmp/xemacs-20.4-b11.tar.gz | tar xvf -
-
-(or the simpler `tar zxvf /tmp/xemacs-20.4-b11.tar.gz' if you use GNU
-tar).
-
-cd to the top level directory and issue an appropriate configure
-command.  The maintainer uses the following at the time of this
-writing:
-
-./configure --with-offix --with-mule=yes --with-dialogs=athena3d \
-	--cflags="-m486 -g -O4 -fno-strength-reduce -malign-loops=2 \
-	-malign-jumps=2 -malign-functions=2" --with-sound=no \
-	--with-xface=yes --error-checking=all --debug=yes \
-	--with-scrollbars=athena3d \
-	--with-canna=yes --with-wnn=yes --wnn-includes=/usr/X11R6/include/wnn
-
-Save the output from configure that looks something like:
-Configured for `i586-unknown-linux2.0.28'.
-
-  Where should the build process find the source code?    /usr/src/xemacs-20.0
-  What installation prefix should install use?            /usr/local
-  What operating system and machine description files should XEmacs use?
-        `s/linux.h' and `m/intel386.h'
-  What compiler should XEmacs be built with?              gcc -m486 -g -O4 -fno-strength-reduce -malign-loops=2 -malign-jumps=2 -malign-functions=2
-  Should XEmacs use the GNU version of malloc?            yes
-  Should XEmacs use the relocating allocator for buffers? yes
-  What window system should XEmacs use?                   x11
-  Where do we find X Windows header files?                /usr/X11R6/include
-  Where do we find X Windows libraries?                   /usr/X11R6/lib
-  Compiling in support for XAUTH.
-  Compiling in support for XPM.
-  Compiling in support for X-Face headers.
-  Compiling in support for GIF image conversion.
-  Compiling in support for JPEG image conversion.
-  Compiling in support for PNG image conversion.
-  Compiling in support for Berkeley DB.
-  Compiling in support for GNU DBM.
-  Compiling in Mule (multi-lingual) support.
-  Compiling in support for OffiX.
-  Using the Lucid menubar.
-  Using the Athena-3d scrollbar.
-  Using the Athena-3d dialog boxes.
-
-Then type make and you should have a working XEmacs.
-
-After you have verified that you have a functional editor, fire up
-your favorite mail program and send a build report to
-xemacs-beta@xemacs.org.  The build report should include
-
-1. Your hardware configuration (OS version, etc.)
-
-2. Version numbers of software in use (X11 version, system library
-   versions if appropriate, graphics library versions if appropriate).
-   If you're on a system like Linux, include all the version numbers
-   you can because chances are it makes a difference.
-
-3. The options given to configure
-
-4. The configuration report illustrated above
-
-5. Any other unusual items you feel should be brought to the attention
-   of the developers.
 								-*- text -*-
 
-	   XEmacs availability information.  Last Modified: 10-feb-96.
+	   XEmacs availability information.  Last Modified: 25-Mar-1997.
 
 XEmacs is available via anonymous FTP from ftp.xemacs.org (128.174.252.16)
 in the directory /pub/xemacs/.
 ftp.xemacs.org is the primary distribution point, but you may find
 copies of it at other sites as well.  Some sites to try include:
 
-	ftp.ai.mit.edu:/pub/xemacs/
-	ftp.uu.net:/systems/gnu/xemacs/
-	ftp.sunet.se:/pub/gnu/xemacs/
-	ftp.cenatls.cena.dgac.fr:/pub/Emacs/xemacs/
-	liasun3.epfl.ch:/pub/gnu/xemacs/
-	ftp.th-darmstadt.de:/pub/editors/xemacs/
-	audrey.levels.unisa.edu.au:/xemacs/
-	sunsite.auc.dk:/pub/emacs/xemacs/
-	sunsite.doc.ic.ac.uk:/gnu/xemacs/
-	uiarchive.cso.uiuc.edu:/pub/packages/xemacs/
-	ftp.technion.ac.il:/pub/unsupported/gnu/xemacs/
-	thphys.irb.hr:/pub/xemacs/
+	ftp://ftp.ai.mit.edu:/pub/xemacs/
+	ftp://ftp-digital.cern.ch:/pub/beta/xemacs-20.0/
+	ftp://ftp.uu.net:/systems/gnu/xemacs/
+	ftp://ftp.sunet.se:/pub/gnu/xemacs/
+	ftp://tp.cenatls.cena.dgac.fr:/pub/Emacs/xemacs/
+	ftp://ftp.th-darmstadt.de:/pub/editors/xemacs/
+	ftp://sunsite.doc.ic.ac.uk:/gnu/xemacs/
+	ftp://ftp.ibp.fr:/pub/emacs/xemacs/
+	ftp://uiarchive.cso.uiuc.edu:/pub/packages/xemacs/
+	ftp://ftp.technion.ac.il:/pub/unsupported/gnu/xemacs/
+	ftp://thphys.irb.hr:/pub/xemacs/
+	ftp://sunsite.cnlab-switch.ch/mirror/xemacs/
+	ftp://ftp.unicamp.br:/pub/xemacs/r20.0/
+	ftp://ftp.usyd.edu.au:/pub/Xemacs/
+	ftp://ftp.lab.kdd.co.jp/xemacs/
+	ftp://SunSITE.sut.ac.jp/pub/archives/xemacs/
 
 The most up-to-date list of distribution sites can always be found on
 the XEmacs WWW page, http://www.xemacs.org/.  Try to pick a site

etc/w3/stylesheet

 
        p  { display: block }
  pre,xmp  { display: block; white-space: pre; }
-blockquote{ display: block; margin-left: 5; margin-right: 5; }
+blockquote{ display: block; margin-left: 5em; margin-right: 5em; }
 
 /*
 ** How to draw form elements.
       dir { display: block;     }
      menu { display: block;     }
        dt { font-weight: bold; display: list-item }
-       dd { display: list-item; margin-left: 5; }
-       li { display: list-item; margin-left: 5; }
+       dd { display: list-item; margin-left: 5em; }
+       li { display: list-item; margin-left: 5em; }
     ul li { list-style: circle; }
     ol li { list-style: decimal; }
 
Add a comment to this file

etc/xemacs-white.xpm

Removed
Old image
-/* XPM */
-static char *noname[] = {
-/* width height ncolors chars_per_pixel */
-"388 145 25 1",
-/* colors */
-"` c #787879",
-"a c #686869",
-"b c #A6AAF5",
-"c c #585859",
-"d c #484849",
-"e c #09090B",
-"f c #5256D7",
-"g c #989CEA",
-"h c #363ACC",
-"i c #C7C8CF",
-"j c #282829",
-"k c #FFFFFF",
-"l c #13154C",
-"m c #7074DF",
-"n c #D9D9DB",
-"o c #232788",
-"p c #383838",
-"q c #4249D0",
-"r c #B6BAF9",
-"s c #868AEB",
-"t c #A8A8A9",
-"u c #989899",
-"v c #6266DB",
-"w c #888889",
-"x c #B9B9B9",
-/* pixels */
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkknkkkkkkknkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkknikkkknninkkkkkkkkkkknninnnkkkkkkkkkinkkikkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkknknkkkkkkkkkknkkkkkkkknkkkkkknkkkkknkknkkkkkkkkkkkxkkkkkkknkkkkkkknkkkknknkkkkkkknkkkkknknnkkkkkkkkknkkknkkkkknkkkkkkkkkkkkknkkkkkkkkkkkkknkkkkkkkknkkkkkknkkkkknkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkknnkknnnnikkkkkkkkkknnnnkkknnnnnkkkinnikkkkkinnkkkkkkkkkkikkkkkkknkkkkkkknnkkkkkkkkkkkinnnnkkknnnkkkkkkkkkknnninnkknnnnnkkknnninkkinnnnkkkkkkkkkkinnnkkknnnnnkknnnnnkkknkxnkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkknkkknkkniiiinkknkkknkknkkknkknkkkknkknxkkkkkkkkkkkkkkkkkkkkknkkkkkkiinnkkkknkkkknnnnnxkkkkxkkkkniiiinknnknknkknkkkkkknkkkknknnnnnikkiiiiikkknkknkknkkkknkknkkkknkknikkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkknkkkkkkkkkknkkknkknkkkknknkkkknkknnikkkkkkkkkkkkkkkkkkkknkknkkikkknkkkknkkkknnnknnkkkxkikkkkkkkkkknnknknkknkkkknknkkkknkinnnnnkkkkkkkkkknkknkknkkkknkknkkkknkkinnkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkknnkknkkkxkkkkkkkkkknkkknkkinkkikknnkknnkknkkikkkkkkkkkkkkkkkkkkknkknkkikknnkkkknkkkkkxkkkkkkikkkikkkkkkkkknnknknkknnknxkknnkkinkkxkkkkkkkkkkkkkknkknkkkikknikkinkkikkknknnkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkknkknkkninnikkkkkkkknxkkixkkkixxnkkknxxnkkiikkxxkkkkkkkkkkkkkkkknxxxxxkknxxkxnkkixxnkkkkxxikknxiknxnkkkkkkknxikxknnkkixikkkknxikxnkkixikkkkkkkkkkixkkxxkkkixnkkkkixxkkkxnknxikkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkknkkknkkkkkkkkknknkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkknkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkknkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkknkkkkkkkkkkknkkkkkknkkkkkkkkkkkknkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkknkkkkkkkkknkknkkkkkkkkkkkkknkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkknkkkkkkkkkkknkknkkkkkkkkkkkkknkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkknknkkkkkkkkkkkknkkkkkkkkkknkknkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkknkkkkkkkkkknkkkkkkkkkknkknkkkkkkkkkkknkkkkkkkkkkkkkkknkkkkkkkkknkkkknkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkknkkkkkkkkkkkkkknkkkkkkkkkkkknkkkkkkkkkkkkknkkkkkkkkkkkkkknkkkkkkkkknkkkknkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkknknkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkknknknkkkkknkknkkkkkkkkkkkkkknkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkknknkkkkkknkknkkkkkkkkkkkkkknknknkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkknkkkkknkknkkkkkkkknkkkkkkkkkkkkkkkkknkkkknkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkknknkkknkkkkkkknknknkkkkknkknkknkknkknkkkkkkkknkkkkkkkkkkkkkkkkknkkkkkkkknknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkknkkkkknkkknkknkkkkkkkknknknkkkkkkkknkkkkknkknkkkkkkkknkkkkkkkkkkkkkkkkknkkkkkkkknknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkknkknknknkknkkkkkkkkkkkkkkkkkkkkkknkkkknkkkknkknuunnkknkkkknkkknkkkkntkkkkkkkkkkiikkkkkkknkkkkkknkkkknnkkkknnkkknkkkkkkkkkkkkkkkknkknkknkkknknkkkknkkkkkkkkkkkkkkknkknkknkkkkkkknkknkknknkknknkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkknkkkkkkkkkkkknkkkkkkkkkkkkkkkkknkknknkkkknkkkkkknkkkkkkkkkkkkkkknkknkknkkkkkkknkknkknknkknknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkknkknkkkknkkkknkkkkkkkkkkkknkkkkkkkkkknktnkkkkiknkkkknkkkkkkkkkkkkikkkkkkkkkkkinkkknkkkkknkkkknknkkukkkktkknkknkkkkkkknknkknkkkknknknknkkkkkkkkkkkkkkkkkkkknkkkkkkkkkknkknkkkknkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkknkknkkkknkkknknkkknknknkkkkkknknknkknkkkknkknknkknkkkkkkkkkkkkkkkkknkkkkkkkkkknkknkkkknkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkknkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkknknkkkkkknknkkkkkkkknkknkkknkkkkkknkkkkkkkkktkkkknikkknnkixnknininnnkkxkninkkkkiikikknniikkkkknkkkkkkkxnknkkiikkknknkkkkkkknkkkknkknkkkkkknknknkkkkknkknkkknkkkkkknkkkkkkkkkkkkkkkknkknkknkkknkkknkkkkkkkkkkkkkkkkkkkkkknkkkkknkknkkkknkkkkknkkkkknkkkkkkkknkkknkknknkkkkknkknkkkkkknkknkkknkkkkkknkkkkkkkkkkkkkkkknkknkknkkknkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkknkknnknkkknnkkkkkkknkkkkkkkkknkkknkkkkkkknnknkkkxnkkkknixtkkxuxuxxikitxiukkktiiuxkknixxikkkkknkkknkktkkkkkktkkkkkkkkkkknkkknknkkkknknknkkknkkkkkkkknkkkkkkkkknkkknkkkkkkkkkknknknkkknkkknkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkknkknkkkkkknkkkkknkknkknknnkkknkkkkkkkknkkkkkkkkknkkknkkkkkkkkkknknknkkknkkknkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkknkkkkkkkkkkkknkkkkkkkkknknkknkkknkkknknkknknkkkxkkkkkkxknknkiuuukknukxkkxkxnkkktkikkkkxkkktutikknkkknknkkkxknknkkxnknkknknkkkkknkkkknknkkkkknkkkkkkkkkknknkknkkknkkknknkknknkkkkkkkkkkknnkkknkkknkkknkkknkkkkkkkkkkkkkkkkkkkkkkknkknkknkkknknknknkkkkkkknkkkkkknnkkkkkkkknkkknkkkkkkkkknknkknkkknkkknknkknknkkkkkkkkkkknnkkknkkknkkknkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknkkkkkkkknkkkkkkkkknknkkkkkxkkkknkxknkkntnktnkkwkxkkxkxkkkkxkxkkkkxkkxnknxkkkkkkkkknkkxnkkkkkxkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknkkkkkkkkknkkkkkkkknkkkkkknkkkkknkkknknkkknkkknkkkkkkknkkkkkkkkkkkkkkkknkkkkkkkkkkknkkknkkkkknkknkkkknkkkkkkkkkknkkkkkkkkkkkkknknkkkkkkkkknkkkkkkkknkkkkkknkkkkknkkknknkkknkkknkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkknnknnkxknkknxkknkxkkkwknkwkxkkxkxunkxnkntkkttkktkkixkkkknkkkknkktkknknnxkknkknknknkkkkkknkkkknknkkkkkkkkkknkkkkkkkkkkkkkkkkkkkknknkknkknkkknkkkkkkkkkknkkkknknkkkknkkkkkkkkkkkkkkkkkkkknkknkknknkkknkkkkkkkkknkknkkkkkkknkkknkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkknknkknkknkkknkkkkkkkkkknkkkknknkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknkkkkunkkxwwwwikkuwunwkwwktikwnwnwwnkkknwwittkiwwnwnnkkkknkkkkkntkkkktnnkknkkkknknknnnnnnnnnnnnnkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknnkkkkkknkknnkknkkknkknknkkkknkkkkkkkkkkknknkkkkkknkkkkkkkkkkkknkknknnnknknkkknknknknnkkknknknknkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknnkkkkkknkknnkknkkknkknknkkkknkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkrrrrrrrrrbrrrrrrbrrrrrrrrrrrrrikinnkkknirrrrrrrrbrbrbrrbrrriknkkkkkkrrrrrrrrrrrrrrbrrrbrbrrrrbrrrrrrrrrrrrrrrrrrssssssgsggbkkkkkkknkkkkkkkkkknknkknkkkkkknkkkkkkknkkkkknknkkkkkkkkknknkkknknknkkkkkkkkknkkknkknknknknknkkknknkkkknknkknkknknkknkknknkkkkkkkkkkkkkknkkkkkkkkkknknkknkkkkkknkkkkkkknkkkkknknkkkkkkkkknknkkknknknkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkrhhhqhhhhhhhhhhhhhhhhhhhhhhhhhhmkkknkkkivhhhhhhhhhhhhhhhhhhhmknknkkkrhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhtnknkkkknnkkkkkkkkkkkkknkkkkkkknkkknkkknknkkkkknknkkkkkkknnnkknkkkknknkkkknkknkkkkkkkkkkkkkknkkknknnkknknkkknkknknkkkkkkkkkkknknnkknkkkknnkkkkkkkkkkkkknkkkkkkknkkknkkknknkkkkknknkkkkkkknnnkkknkkknknkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkknknknkkihhhhhhhhhhhhhhhhhhhhhhhhhhhhhhodknkkkknvhhhhhhhhhhhhhhhhhhhockkkkkkihhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhoenkkknnkkkkknkknknkknkknknnknkkkkkkkkkknkknkknkkkkknknkkkkkknkknknkkkkkkkkkkkkknnkknknknnkknknknkkkknkknknkkkkknkknnnkknnkkknkknknkkknnkkkkknkknkkknknkknnnkkkkkkkkkkkknkknkknkkkkknknkkkkkknkkkknkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkknkkknkkmohhhhhhhhhhhhhhhhhhhhhhhhhoooldkknknkkbhohhhhhhhhhhhhhhhholdnknnkkkmohhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhlcnknknkkkkknkkkkkkknknknknkkkkkkknkknnkkkknkkkknnkkkkkkknknkknkkkkknknnkkkkknkkknnkkkkkknknkknknknknknknknknknkknkkknkkkknnkknknknknknkkkkknkkkkknknkknkkknknkkkknkknnkkkknkkkknnkkkkkkknknknnknkkknknnkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkknkknkkkdpllhhhhhhhhhhhhhhhhhhholeepddwnkknknkkwdddqhhhhhhhhhhooeepwknkkknkkddjeoqhhhhhhhhhhhhhhhhhhleeeeeeelloohhhhhhhhhhhhhhhhl`nnnnknknknknnknknkknkkkkkknkknkkkkkkknknkkkkkkknnnknknkkknnkkknnnkkkkkkknkkkknkkknkkkkkkkknknkkknkkkknkkknkkknknkknnknkkkkkkkknknknkkknknknknknkkkknkkkkkkkkknkkkkkkknknkkkkkkknnnknknkkknkkkknknkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkknkx`fhhhhhhhhhhhhhhhhledtnnknnnnnnnnnkkkknshhhhhhhhhlej`nnnnniknknkkkkknghhhhhhhhhhhhhhhhoel`xnninitwudplohhhhhhhhhhhhheunnnnnnnknknkknkknnnkkknknkkkkkkkkkknkknkknnnkkkkkkkkkkkkkkkknkkkknnknkkkkkkkkkkkkknkkknkkkkkknnkkkknkkknknnnkkkkkkkkknkkknknkkkkkkknkkknknknknknnnnknknnknkkkkkkkkknkknkknnnkkkkkkkkkkkkknknkkknknnknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknnmhhhhhhhhhhhhhhhlcxxiixixxxxiinnnkkkighhhhhhhheeaxxxxxxxiiinnknkknnivhhhhhhhhhhhhhhhejxxixxxxxxxxxii`dohhhhhhhhhhoetxtxxinnnnknknknknknnnknkknknkkkknkkkknknnkkkkkkkknkkknkknknknknknkknknknnkkkkknkkkknkkknnknknkkknkkkknknkkknknknknkkkknkkkkkknknkkkkkkkkknknknkknknnknkkknknkkknkkkkknknnkkkkkkkknkkknkknkknknkkkkknkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkknkkkkknkkkkkkkkkkkkknirfhhhhhhhhhhhhhhecuuwwuuuuuuutxnnnkkrvhhhhhhoeewuwwwuuuuutxxnnknkknrvhhhhhhhhhhhhhhoewwuwuuuwuuwuwuuuuwdqhhhhhhhhoew`wwwuxnnnkknkkknknknknknkkkkknnkknkkkknknnknnknkkkkknkkkkkkkknknkkkkkkkkknknkkkknkkkkkkknkknkknkkknknkkknnknnnkknkkkknknkkknkkkkknkkkkknkkkknkkknkknnknnkkkkknkknknkkknknnknnknkkkkknkkkkkkkkknnnkkknkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkknknitshhhhhhhhhhhhhhlcccccaaaa``wuxinnkrbhhhhhhoejdccaacacaaa`utxnnkknnrvhhhhhhhhhhhhhhllccaccaaaaaaaaaaaaaaaqhhhhhhhljcdcca`txnkkkkkkknknkkkkkknnnknkknnnknkkkkkkkknkkknnkkknkknknkkkkkknkknnkkkknkknkkkkkkkkkkknkknknnknkknknkknkknknknknkknknkkkknknkkkkkkkkkkkkkkknknnkkkkkknnnknkknnnkkkkkkkkkknkkknnkkknkknknknkkkkkkkknkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkniughhhhhhhhhhhhhhljjpjpppdcaa`utxnnirfhhhhhoeejjpjpjpppddcaaccxnkkinrhhhhhhhhhhhhhhhejjpjppppjpccaccccccddvqhhhhhheejjjjpawxinkkkknkkknknnnnnkknknknkknknnkknkknknknnkknkkkkknkknknkkkkkkuukknkkkkknkkkkkkkknkkknnkkkknkkknknknknkknknknkkkkknkkkkkknknnkkkkknkkkknkkkknknnnkknknknnknknnnkknkknknknnkknkkkkknkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknnituvhhhhhhhhhhhhhoeeejejpdca`wuxinnrmhhhhhoelpjejejejjjdda`ctnkkkkxnrhhhhhhhhhhhhhhoeeeeejejpdpcaaa`aaaccddmhhhhhheeeeejpc`cdannknknkknknxa`cackknknnnnkccnkcaknkkknknkkkknkkknknkkkkkkkkktkkkkkkkkknkkkkkkkkkknkkkknkknkkkkkknknknknkkkknknknkknkkkkkkkkkkkkkknknknknknknknkkkknknknnknknnkkkknkkknknkkkkkkkknknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkniitshhhhhhhhhhhhhheeeejjpc`wutxinnrshhhhhoejcdpeeeeeejpc`aaautnnkttishhhhhhhhhhhhhhleeeeeeljpccwaa`uwwacaacsqhhhhoeeeeeejcwxunknkkkittkkktkntktnknxtinknndknwnkkkknknktitniikkkntxkkkkkxxkxkkkitxkkkknknkknxxxkxnnnkitxknntkttnknknknknnkkknkknkkknknkkkkkkknknkkkkknkkknknknnkknknnknknnknknnkkknkknnkkkknkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknknnirhhhhhhhhhhhhhheeeeepc`utxxinnighhhhhoepcapjeeeeejjp`wwwatxkknt`rmhhhhhhhhhhhhhhleeeeeejpc`ata`uxxca`ccwwmhhhhleeeeejpawxunkknkktttwnnkkktkkkn`uuu`nknn`cknnnkkkkkkt`xaxuikn`xx`nkk`ttaukk`uxw`nkkkkkkknwuu`xwknntxuiki``ut`xkknkknknnnknkkkkknkkkkkkkknkkkknnkknkknnkkkkkknknnknnnnknknnknnkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkknknnknivhhhhhhhhhhhhhleeejpauxinnnnrbqhhhhoedwiwapjeeejjdjtxinunnnkkktrfhhhhhhhhhhhhhheeeeeeeejwuwctnnni`uuwcutshhhheeeeeejpauxuknnknkua`uknnkktnknn`ttuaxknn`wknkxaaacakkckxkkxkxkkkktktnkkkwki`ttxaxnwaaa`tkttntktkkn`autkktnknkwkknknkkkkkkknknkknkkkkkkkknnnknkknkknknknnkknkknkknknknnnnknknnkkknnkkknkkkkkkkkkkkkkknkkkkkknkkknkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkknkkkkkkkkkkknknknkknknknshhhhhhhhhhhhhoeeejd`uinnkkrrqhhhhhednuxucpejejpda`xinntnkknnkxrhhhhhhhhhhhhhhoeeeeeejpaux`x`nnnx`ttuuiighhhheleeeejp`tiunkntktxnnwkknkntknkx`ttttnnkwxttkkkkkkkkknaktkktktkkkktktknnktkx`ttttnkknkkkkkxxkuntnkunkntkkunknkwnkkknkknknnknknknknkknnknkkknknnnknknnkknknknknknnnknkkkknkkkkkknkkkkknkkkkkkkkkkkkkkkkknkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkknknkkkkkknknknknkbhhhhhhhhhhhhhheeejd`tinknrbqhhhhoejnnu`wdjejjjauxxnnnkuknkknnbshhhhhhhhhhhhhhleeeeeejc`titni`knkcxkniknrhhhoepjeeejd`titnknukwkkn`nknkktkknncxkknkktxnkcnknkkknkkkaktkktkitkkuxkn`knw`nkaxnnnnkkkkkkkktxntntnnukktxkkx`nkuinnnknknknkkkknnkkkknnkkknnknknkknkkkkkknknkkkkknknkkkkkkkknnknkkkkkkkkkkkkkkkkkkkknkknkkknnkknkknkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkknknknnknknkkknnnfhhhhhhhhhhhhhleejd`tnkkibqhhhhheeinnxajjjepdadd`xknwcccwkntarmhhhhhhhhhhhhhheeeeeeepcwx`unkcanknwcwxknrhhhoecpeeepcwwccccaxkicctuwkntcccnnknwa`xkkaakkackkknkknnaakuikakkiacxknknacxwwnnua`xnknkkkkkiawkanxwkuccicxktn`ciknkknknknknknkkkkknkknnnknnknnnnnkknnnkknknknknnnknnknknkkkkkkkkknknknnkkkkkkkkkkkkkkkkknknknkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkknkkknnknkknmhhhhhhhhhhhhhoeejpauxnirfhhhhoeltxnit`cpjpd`utnnkknnnknknkknrqhhhhhhhhhhhhhoeeeeeejpauxknkknnknknknnkkrhhhld`djjjpcwxnnknknnknknknkknkkknkknnnnnkknknkkkknkknkkknkkkkkkkkkkkkkkkkknnnkkknkknkkkkkkkkkkkkkknnnkkkknnktkkknkknnnknnkknkknkknkknkkknkknnkkkknnnnknnnknknkknknknnnknkkkknkkkknkkkkkknkkkkkkkkkkkknkkkkknkknknkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkknkkkkkkknknknnknkknknknbhhhhhhhhhhhhhheeepcuxirvhhhhheliknxtwcpppcawxinknknknnknknknbhhhhhhhhhhhhhhoeeeeeejp`unkkkkkknknknknknghhhe`wcpjjpattnnnnnkknknknknnknkknnkknkkknkkkkkkkknknkknkkknkkkkkkkinknknkknknnnknkknknkkkkkkkkkkknkknknnkknxpctkkkkkkknkknnknnkknnkknknknnnknnnnnkkkkknknkknknkknnkknknknnkkkkkkknknnknkknkkkkkkkknnknkknknknknkkknkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkknkkkknnkkkkkkkknknknnkkkkkiqhhhhhhhhhhhhhleejcwrrvhhhhheennnitwadppc`utxnnnkkknknnknnkrshhhhhhhhhhhhhhleeeeeejdwuxinkknnnnknnknnnnmohetuapjjd`xxnnknnknkknknknknnnkknknknknknnkknknnkknnknknkkkkknkkkknnnknkknnknnknnknkknkkknnknkkkkknnnknknknknnnkkkkkkknnnknnnnnknnnkknkknkknnnnnnnnnkknknnnknnkknknkknkknnkkknnnknknkknkkkkkkkkkkkknknkkkknknkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkknkkkkkkkkknkknkkkknknkkknnnknmhhhhhhhhhhhhhoeejdtrvhhhhhelnnnitwadppd`uxnnnknnnnknnnknkkrvhhhhhhhhhhhhhheeeeeeepcwxinnknrgvbrknnnnknncjlit`dppcwxnnnnknknnnknkknkknknknknnnnkkkknnnnkknnkkknkkknkkknkkkknnnnnnknknnnnknkkkkknknkkkkkkkkkkkknnkknnnnnnnknkkkkkknnnknnkkknknnknnkkkknknkkkknnknkkkknkknnnnninnkkkkknkkkknknknkknkknkknkkkknnnnknkkkknnkknnnkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknkkkkknghhhhhhhhhhhhhheeesrvhhhhoeeinnxtwadppcawtikkkkkkknkknnknknrhhhhhhhhhhhhhhoeeeeeejp`uxnnnnnrqhhwxknnknnkkkkixwapdauinnknknkkknknnniirnikkknkknnniirrggsgikknnnknnkknkkknirrrgsggnnknkknknkkkkkknkkkknkkkkkkknknknirrbsssbnnnnkkkknnnnniiiikkkkkkkkkkknnknnnkknknnnnnnirrrsssggrnnnkkknkkknknnknknnkknkknrrrbsgsgrnnnkkkknrsgrkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknnkkknnknnhhhhhhhhhhhhhhlewrvhhhhhelinnitwadppdawtinkkkknkkknkknknknghhhhhhhhhhhhhhoeeeeeejd`tiinknrshhhetkkkkkkkkknnxwcdd`uiknknnnnniiirrrssvqsikkkkknkrrgvhhhhhhminknknknknnknrbmqhhhhhhmiknknknknnnknkkknnknkkkkkkkkirrsvhhhhhhqgkknnrrrgssgssvmsnknkkknkkkknnnkkkknknknirbsmqhhhhhhhfsrkkkknkkknknnnkknknnnrbmfhhhhhhhfsrnnknrghhhtkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknkkkkknnfhhhhhhhhhhhhhoprvhhhhheennnxtwaddpdawxiinkkkkkknknknkknnrmhhhhhhhhhhhhhheeeeeeejcwxinnkirqhhoekkkkkkkkkkknxuaccwxrrrrrrssssvvfhhhhhhlankkkkirgqhhhhhhhhhqxnnknknkknrbmhhhhhhhhhhhgknkknnkkknknnkkkknkkkkkknrrsqhhhhhhhhhhfnkrshhhhhhhhhhdakknkkknkkkknnnknkkknrrgvhhhhhhhhhhhhhhmnknknnknknknnnkknrbmhhhhhhhhhhhhqvsbrgqhhoekkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknnknknghhhhhhhhhhhhhhrshhhhhelinnitwacppdawxinnnnkkkkkkkkkkknkkrfhhhhhhhhhhhhhheeeeeejpcuxinnirmhhhopkkkkkkkkkkknit`aaugvfhhhhhqhhhhhhhhhhhetnnknrrvhhhhhhhhhhhhhinnnknnnrsqhhhhhhhhhhhhhwknkknknknkknknknkknkkkirsqhhhhhhhhhhhhhdnrfhhhhhhhhhhlakkkknkkknkkkknnnnnirgfhhhhhhhhhhhhhhhhhfnnkkknknnknknknrsqhhhhhhhhhhhhhhhhhhhhhhodkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknkkrhhhhhhhhhhhhhhshhhhheeinnituadppdawtinkknwctkkkkkkxkkkknrhhhhhhhhhhhhhhoeeeeeejp`uinnnrghhhhlankni`dxkknknixw`wxshhhhhhhhhhhhhhhhhhljnnnnibqhhhhhhhhhhhhhqonntnnirshhhhhhhhhhhhhhhhwcxnknknknknkkkknkknkrbvhhhhhhhhhhhhhhqhurhhhhhhhhhhhexkknxcwkkkkkkkkkknrbmhhhhhhholeedqhhhhhhhqnnnnknknnnnnnrshhhhhhhholeeelhhhhhhhhhhlckkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknnknnvhhhhhhhhhhhhhhhhhhlexnnixwacdpda`uxnnkkkukknkkkkiwknkkrghhhhhhhhhhhhhhleeeeeejdwxinnrrqhhhhexkniiiiwnkkknnxtutxghhhhhhhhhhhhhhhhhheanknrrqhhhhhhhhhhhhhhho`i`iirvhhhhhhhhhhhhhhhhhlpnknnwdpaknnknkknknrbqhhhhhhhhhoeeehhhhvshhhhhhhhhhoennknnkukkkkkkkknnrsqhhhhhhhlepuxnshhhhhhhhonknnknnknknrgqhhhhhhhledunkiwfhhhhhhhhlwnknnknkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknknnmhhhhhhhhhhhhhhhhhlecxiitu`ddpdawtxnnkkkkunkknkkk`kkkkkrvhhhhhhhhhhhhhheeeeeeejpwtnxrbqhhhhoeuinxttt`nnnkknnxxixrcllhhhhhhhhhhhhhhhetiurbqhhhhhhhhhhhhhhhhhjtxwrshhhhhhhhhhhhhhhhhhoaxinnnkuknknknxtxnrshhhhhhhhhheecxxumhhvvhhhhhhhhhhljtxiiinwknknnkttirshhhhhhhhledtnirmhhhhhhhhhpxnnitiutnnrqhhhhhhhoewnniituxvhhhhhhheuniixxinknknkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknkknkkkkkkkkknkkrhhhhhhhhhhhhhhhhlepwtttu`cpddawuxiinnkkktknkknnkwkkkk`rqhhhhhhhhhhhhhheeeeeeejduxrrsqhhhhhlpudtuw`wainnknknnninxwccashhhhhhhhhhhhoextrbqhhhhhhhhhhhhhhhhhhewurshhhhhhhhhhhhhhhhhhhodttxnnnunknknnuturshhhhhhhhhheedwxtuwfhqhhhhhhhhhhhedacxtttwinnkndubrvhhhhhhhhledw`crbqhhhhhhhhhld`xxaauuwrshhhhhhhhepuiitu`c``qhhhhhhexix`wuuinnininnkkknkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknnkknkkkkkkniqhhhhhhhhhhhhhhlejd`wuwacdpdawtxinnnnknktknnkknkunnnxibhhhhhhhhhhhhhhoeeeepdcwtrrgfhhhhhhhl`iiaw`awainnnkkkknknknwnnrhhhhhhhhhhhhljubbqhhhoelvhhhhhhhhhhhhecrghhhhoeeqhhhhhhhhhhhhojawutxnuknknkna`rghhhhhhhhhoee``ju```shhhhhhhhhhhhoew`awwwuainnnunirvhhhhhhhhoedwwwprmhhhhhhhhhhopjtxwnnntrqhhhhhhhhetwuww`adccshhhhhoeutu``wttnkikkkkkknkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkknkkkkkknkknkknknknkkkkknshhhhhhhhhhhhhoeeedc``adppda`txinnnkkkkntkknnknnunknuishhhhhhhhhhhhhhsrbrrrsssmvhhhhhhhhhhetitaacc``innknknkkknnnukkrhhhhhhhhhhhhedgrfhhhlectbhhhhhhhhhhhoegbqhhheecitmhhhhhhhhhhhoepcautiwnkunkwirshhhhhhhhhhleaaadacpdshhhhhhhhhhhhlecddccawaxnnntirvhhhhhhhhhedc`aa`rhhhhhhhhhhhoep`u`xnntghhhhhhhhhex``ccdppddwfhhhhoea``ccawunniknkkkknknkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkknkkknkknkkghhhhhhhhhhhhhheeejpccddddawuxinnnnnnkkkukkknnknwnnnnrfhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhoeitcccda``inknknknkkkkkunirhhhhhhhhhhhoecrvhhoeecxirhhhhhhhhhhhocrfhhheexnnbshhhhhhhhhhhlejjdauxwnkuknwrshhhhhhhhhhoejw`adpjlashhhhhhhhhhhhejjjejjd`axnnnrrvhhhhhhhhheexp`wa`shhhhhhhhhhhoepdaaxnnbshhhhhhhhhewdcpjjjjdcamhhhhoedddpdcwunkxkkkkkknkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkknkknknnkkkknkrqhhhhhhhhhhhhhleejjppppdcwtxnknkknkkkkkukkknknnwiknkrhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhlpdjacdpjjpd`kknnnkkkkwcddgshhhhhhhhhhhlershhheedpxtbhhhhhhhhhhhorshhheeuinnrmhhhhhhhhhhhleeejdppddddnkrbqhhhhhhhhhhed`pjejjeewshhhhhhhhhhhheeeeejjejppdnnrvhhhhhhhhhoeutwpjlcshhhhhhhhhhhoejjpjdxtgvhhhhhhhhhljjejljjjpp`ghhhhlepjjejcawnxxknkknkkknkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkknknkknnnkkknnmhhhhhhhhhhhhhoeeeejjjdc`txnnnnnnnnnkkkwunkkkknk`nnrghhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhewuwcdpdauxnnnnkknknnkkkkkimhhhhhhhhhhhegbhhheedwtirshhhhhhhhhhhsghhoeeauxxwrfhhhhhhhhhhheeeejpcwxnnnnirqhhhhhhhhhhlewadjjjeljsvhhhhhhhhhhhleeeeeejdatikkrshhhhhhhhhhepu`adpjpshhhhhhhhhhheeejpc`tirvhhhhhhhhhhjjjeejdawttrfhhhljjjejpdwxnkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkknkkknkkkkghhhhhhhhhhhhhheeeejjpcwuxinknkknknkkkkxuinkknknnnkrmhhhhhhhhhhhhhhlelllloohhhhhhhhhhhhoewwcpjjdatxnkkkkknkkknknkkrvhhhhhhhhhhodrfhheejcwtxrmhhhhhhhhhhhrqhhlejawxtubhhhhhhhhhhhheeeeejd`tnkknrvhhhhhhhhhhoeccdjeeejjpbvhhhhhhhhhhhleeeeeejc`tinrbhhhhhhhhhhoeu`cpjjljahhhhhhhhhhoeeeeepawxivhhhhhhhhhhoeeejpawtxiimhhhejjeeepcwxnkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknknkknkkkrqhhhhhhhhhhhhhleeejjc`uxnnnknnnnkkkknnnknnkkkknknnrfhhhhhhhhhhhhhheeeeeeeelllhhhhhhhhhol`cpjjjd`tiknnnkkknknknkknrhhhhhhhhhhhorshhlelpauxxrfhhhhhhhhhhmmhhleepcwtxrmhhhhhhhhhhhoeeeeejd`txnnrshhhhhhhhhhhejcpjjeeejpcrqhhhhhhhhhhheeeeeejjcwxnirqhhhhhhhhhhep`cpjeejpdvhhhhhhhhheeeeejjcwtrvhhhhhhhhhhqeeejd`tinnnshhheadjejpcuxnkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkknkkkknkknkkkkkrvhhhhhhhhhhhhhoeeejpauxinnnnkkkknkkkknnnnknkknnnknrhhhhhhhhhhhhhhoeeeeeeepc`uaqhhhhhhhljdpjljjcwxnnkknknkkkkkknnnshhhhhhhhhhhbghhoeejd`uxtbhhhhhhhhhhhshhoeeepcwutrfhhhhhhhhhhhleeeeejpatxnnbqhhhhhhhhhhoedpjeeeejpcurhhhhhhhhhhhoeeeeeeedauinrmhhhhhhhhhhoecdpjejejd`ufhhhhhhhleeeeeejd`tifhhhhhhhhhhhheejcwtinkkkhhoe`cjjepauinkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkknnknknibqhhhhhhhhhhhhhheeejc`tinkkkkkkkkkkknnknknnnnkkknnishhhhhhhhhhhhhhleeeeeeejdawwuvhhhhhhejpeeelpcwxnnknkkknknknknkrmhhhhhhhhhhqrhhheeepcwutrshhhhhhhhhhfqhheeejpawugbhhhhhhhhhhhheeeeeejd`uinrmhhhhhhhhhhhlepjeeeejjd`bshhhhhhhhhhhleeeeeejdwtirbhhhhhhhhhhhlecjjeeejpawxicooooleeeeeeeejd`tishhhhhhhhhhhhpejdwxnnnnkneejwapjjd`tinkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkknkkkkknkkkkkkkkkknknnknkkkkknkkirvhhhhhhhhhhhhhhhleejdwxnnkknkknnkknnnnkknnknknkkkkrvhhhhhhhhhhhhhheeeeeeeejpdaaashhhhhoeeeeeejpauinknknkkknkkkkknrfhhhhhhhhhhmmhhleejdauturvhhhhhhhhhhqhhoeeeepd``tshhhhhhhhhhhheeeeeejp`tirghhhhhhhhhhhoejjeeeeejdauxmhhhhhhhhhhheeeeeeepcwxnrfhhhhhhhhhhhepjleeejpcwxnkkncppleeeeeeeejdwtibhhhhhhhhhhhhhjjd`xnkkkkknnit`dpjd`tnnkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknkkkkkkrrvhhhhhhhhhhhhhhhhleejd`tnnkkknnknnkkknnkknnnnnnkkkkrqhhhhhhhhhhhhhoeeeeeeejjpdddc`vhhhhleeeeeejd`tnnnkkkknkknknkknrhhhhhhhhhhhshhoeeejdawwwrhhhhhhhhhhhhhoeeeejpda`rfhhhhhhhhhhhleeeeeejdwtirfhhhhhhhhhhhlejeeeeejpawxrvhhhhhhhhhhoeeeeeeepauxrghhhhhhhhhhhlejjeeeejd`uxinnnntwcpeeeeeeejdwxnrhhhhhhhhhhhhhhjp`unnknkknknxucppcwtnnkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkknkkkknkkkkkkknknkkkkirvhhhhhhhhhhhhhhhhhheejp`uinknkknnknnnkknkkknknknnnknbhhhhhhhhhhhhhhoeeeeeeejpdcccc`mhhhhleeeeeepcwtiknknknnkkknkknnshhhhhhhhhhffhheeeepdaw`gghhhhhhhhhhhhhleeeejjdcwbhhhhhhhhhhhhleeeeeepcwxrghhhhhhhhhhhoeleeeeeepc`xxrhhhhhhhhhhhleeeeeejd`tirfhhhhhhhhhhhlejeeeeepcwtinnkinxwcpjeeeeejpawxnnmhhhhhhhhhhhhhhjcwxnkknkknniu`ddcuxnkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkknknkknkkknrvhhhhhhhhhhhhhhhhhhheeepcuinnnkkntknnnknnkkknnknnkknimhhhhhhhhhhhhhhleeeeeeeejcwwwaushhhoeeeeeejepwxnnnknknknnknkkkrvhhhhhhhhhhqhhleeeepca``bmhhhhhhhhhhhhoeeeeejppdbmhhhhhhhhhhhoeeeeeeejawxrfhhhhhhhhhhhleeeeeeejpauxrghhhhhhhhhhheeeeeeejdwtrghhhhhhhhhhhhejeeeeejdauinnknnixuadjeeeejjd`uinkrhhhhhhhhhhhhhhqd`uinkkkkkkitwac`uinnkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkknnknnrshhhhhdfhhhhhhhhhhhhhoeejc`xnnknkainnnnnkkikkkknkknkurvhhhhhhhhhhhhhheeeeeeejdawuttwbshhhoeejeeejdcuxnkknknknkkkknknrqhhhhhhhhhhhhheeeejpcaawrqhhhhhhhhhhhhleeeeeljjarqhhhhhhhhhhhoeeeeeejpaurghhhhhhhhhhhheeeeeeeepcwxirmhhhhhhhhhhheeeeeeepcuxrmhhhhhhhhhhhleeeeeeepdwxinnnkknitwcdjjjjpd`uxinnnmhhhhhhhhhhhhhhqcwxnnnnknnnxu``wtikkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkknkkkkkkkkkknkkkkkkkkkkknrshhhhhljmhhhhhhhhhhhhhoeejdatinknkanknnnuunkkxxknuini`rhhhhhhhhhhhhhhoeeeeeejed`tiiwwishhhljjjeeejdcxinnnkkkkkiuxukuighhhhhhhhhhhhhoeeeeejcaagghhhhhhhhhhhhoeeeeeejjjwghhhhhhhhhhhheeeeeeejd`trfhhhhhhhhhhhoeeeeeeejpauxnrqhhhhhhhhhhleeeeeejd`uirhhhhhhhhhhhhleeeeeejpawxnkknkknnxuwccdddcautinkkkrqhhhhhhhhhhhhhhpauxnknkkknixuutxnnkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkknknknknrshhhhhletrhhhhhhhhhhhhhheeepcuxnkkxxknnkwutwkntwnnutnnsghhhhhhhhhhhhhhoeeeeeeejd`xinuanshhhedppjejpccxnnnnnnnknna`waubmhhhhhhhhhhhhheeeeejepcabmhhhhhhhhhhhhleeeeeejjdbmhhhhhhhhhhhheeeeeeejcwrbhhhhhhhhhhhheeeeeeeejcwtinghhhhhhhhhhhleeeeeejdwtrshhhhhhhhhhhheeeeeeejcatinnkknknnnitu``a`wuxinkkkknghhhhhhhhhhhhhhqp`tinknkkknnxxinnkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkknknknkkkkkknkkkkkknkkrshhhhhleukrqhhhhhhhhhhhhhleejc`tnnkukkknn`da`kknunknuknrmhhhhhhhhhhhhhhleeeeeejpwxinnntishhheuccjjjpacinknwdddd`ktukukrvhhhhhhhhhhhhleeeeeejec`rqhhhhhhhhhhhoeeeeeeelparqhhhhhhhhhhhleeeeeejpawrmhhhhhhhhhhhheeeeeeejpauiirmhhhhhhhhhhheeeeeeejcwxrvhhhhhhhhhhhoeeeeeejpautinknknkknnnnxtttutxinnkkkkkkfhhhhhhhhhhhhhhhd`tnnnknknnnnnnkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknrbqhhhhleuknnmhhhhhhhhhhhhhheejpauinkuknkkutnnwnknunkkunkrfhhhhhhhhhhhhhheeeeeejjpwxnnnkunmhhlexcapjjd``inkknnnknknutkunrhhhhhhhhhhhhhleeeeejjjcughhhhhhhhhhhhleeeeeeejpgghhhhhhhhhhhhleeeeeejd`trqhhhhhhhhhhhleeeeeeejc`tinrqhhhhhhhhhhoeeeeeejpauirhhhhhhhhhhhhoeeeeeejp`tninnkknknkknnnnxiiinnnnknnknknqhhhhhhhhhhhhhhjawtnknkkkknknkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkknknknkkkkkkknkkkkibqhhhhoe`knnxghhhhhhhhhhhhhheeepcwxiniuknk`kkiaknn`nnuuknrhhhhhhhhhhhhhhoeeeeeejdduinnknukgqhlan``dppcw`irikknnnnnnuuktnshhhhhhhhhhhhoeeeeeejjdabshhhhhhhhhhhheeeeeeeejdbmhhhhhhhhhhhoeeeeeeejc`bghhhhhhhhhhhheeeeeeejpcuxnighhhhhhhhhhhleeeeeejd`uighhhhhhhhhhhhleeeeeejc`tnkknknkknkknkkknnnnnnnnnknknkkrqhhhhhhhhhhhhhhjautnknkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkknrbqhhhhoedniniusfhhhhhhhhhhhhhleepc`tinnakkkidcuwwnnicdxdtishhhhhhhhhhhhhhleeeeeeejjpankucddcadejppjjddjpdbsqmnkkknnxd`kdrmhhhhhhhhhhhhleeeeeeeec`rfhhhhhhhhhhhlleeeeeejd`rqhhhhhhhhhhhoeeeeeeepaurshhhhhhhhhhhheeeeeeejd`tinrmhhhhhhhhhhheeeeeeejc`trshhhhhhhhhhhheeeeeeepcuinnkknkknknnnkkknnknknknnknkkkknshhhhhhhhhhhhhhod`uxnnkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkknknkknkknkibqhhhhoednnixu`amhhhhhhhhhhhhhoeejd`uinnxxnkknknkkkknknknkrvhhhhhhhhhhhhhheeeeeeejcwxnnkkkkkknkknntwcdc`tibqhhcnkkkkknnnkrqhhhhhhhhhhhheeeeeeejpctbhhhhhhhhhhhheeeeeeeepdgghhhhhhhhhhhheeeeeeejdaurfhhhhhhhhhhhoeeeeeeepawxnnbhhhhhhhhhhhoeeeeeejpauirvhhhhhhhhhhhheeeeeejdatinnikknkkkkknknkkkkkknknnkknknknnmhhhhhhhhhhhhhhlc`tinknkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkirvhhhhhedkniiuwcdshhhhhhhhhhhhhheeepauxinnknkkkkknnkknknknnrqhhhhhhhhhhhhhheeeeeejpauxnnnknknkkknnnxwcdawxrvhhoeikkknknknnbhhhhhhhhhhhhleeeeeeejdabshhhhhhhhhhhoeeeeeeejparmhhhhhhhhhhhheeeeeeejcwxrhhhhhhhhhhhhleeeeeejp`uinrshhhhhhhhhhhleeeeeejd`uirvhhhhhhhhhhhheeeeeejdwtiknnnkkkknnknknkkkkkkkkknnnnkkkknnvhhhhhhhhhhhhhljcwtinkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkknkkirvhhhhoejknnxuwcdp`fhhhhhhhhhhhhhleepcwtinnnnnknnkkkkkkknkknghhhhhhhhhhhhhhoeeeeeejd`tinknkkkkkkkknitwacaurshhhlpnknnnknknimhhhhhhhhhhhheeeeeeeepcwrfhhhhhhhhhhhleeeeeejjdwrfhhhhhhhhhhhleeeeeejpaurghhhhhhhhhhhheeeeeeejcwxinrqhhhhhhhhhhheeeeeeejdwtnrhhhhhhhhhhhhoeeeeeejcwxnknkknkkkknnnkkkkkkkknkknknnnnkknnifhhhhhhhhhhhhhedauinnkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkknkkknknkkkrrvhhhhheliknit`adpdcshhhhhhhhhhhhhoeejdwtinnknknknknknknknnnishhhhhhhhhhhhhhleeeeeejdwtnnkkknnkkknknnxw`a`rbqhhhlwnnknnknnnrvhhhhhhhhhhhheeeeeeejdatbhhhhhhhhhhhoeeeeeeljpatbhhhhhhhhhhhheeeeeeeedatishhhhhhhhhhhoeeeeeejpawiirmhhhhhhhhhhhheeeeeeepcwxnrhhhhhhhhhhhhoeeeeejpawxnknnnknkkkkkkkkkknkkkrsrkknknnknknnbqhhhhhhhhhhhhejd`tinkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkknnrvhhhhheennnixuadpdcabhhhhhhhhhhhhhheejdatinnnnknkknknknnnkknrfhhhhhhhhhhhhhheeeeeeepawinnkknknkknnnnnxtw`brfhhhoexknnninnnnrhhhhhhhhhhhhleeeeeeejcwrshhhhhhhhhhhoeeeeeelpcwbshhhhhhhhhhhheeeeedejdwtrmhhhhhhhhhhhoeeeeeejd`uiirqhhhhhhhhhhhoeeeeeejp`txnrhhhhhhhhhhhhoeeeeejd`tnikknkknnrnkkkknknkkknbhhmnkknnknkknishhhhhhhhhhhhljjcwxnnkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknrmhhhhhllnnnituacpdc`urhhhhhhhhhhhhhhleepcwxnkknnnnkknknkknnnnrhhhhhhhhhhhhhhoeeeeeejpatinkknnkkknkkknnnxtxrvhhhholnknnixxinishhhhhhhhhhhheeeeeeejpaurvhhhhhhhhhhheeeeeeljpaurvhhhhhhhhhhhleeeejrsaawxrvhhhhhhhhhhhleeeeeejc`tnrshhhhhhhhhhhhleeeeedddwtnnrhhhhhhhhhhhhoeeeeejdwxxnnkknnnrghgkkkkknnkkkshhhcnkknnnnknnimhhhhhhhhhhhoejpawinkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknnrshhhhhleunnixwacppc`uxrmhhhhhhhhhhhhhleejd`tinkknknknnnnknknnishhhhhhhhhhhhhhoeeeeeejd`xinkkkknkknnknnnnnrrvhhhhheannnxxtxinrmhhhhhhhhhhhoeeeeeeejc`xrhhhhhhhhhhhheeeeeeljc`trqhhhhhhhhhhheeeeebghhctirvhhhhhhhhhhhleeeeeepauxibqhhhhhhhhhhhheeeeelrsswinkrhhhhhhhhhhhhoeeeeejcwxnnkkknkrbqhhfkkknkkkknshhhenkkkknkkknirqhhhhhhhhhhoeejd`tnnkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkrshhhhhleunnituacpdd`wxnnshhhhhhhhhhhhhheejpauxnnnkkknknnnnkknkimhhhhhhhhhhhhhhleeeeeejcwxnnkknnnkknnknknnirvhhhhhhexnnxuwwuxirfhhhhhhhhhhhleeeeeejjawrshhhhhhhhhhhleeeeeelpawrbhhhhhhhhhhhheeeearqhhl`iivhhhhhhhhhhhleeeeejp`wrrmhhfhhhhhhhhhheeeeegbhhfikkiqhhhhhhhhhhhheeeeejcuxnknkkkirfhhhldkknkkkkimhhhlnnnnkknnnknishhhhhhhhhhoeejpauxnkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkknrshhhhhletnnixwaddpc`wxiknrhhhhhhhhhhhhhheeejcwxnnknknknnnnnnknnrfhhhhhhhhhhhhhheeeeeejpaunnnnnnknkkkknkkkrrvhhhhhhoennxtwaawxibhhhhhhhhhhhheeeeeeejdaurvhhhhhhhhhhheeeeeeejpaurshhhhhhhhhhhoeeejrmhhoeunivhhhhhhhhhhhleeeeejd`trshhmhhhhhhhhhhoeeee`rqhhlcnnnvhhhhhhhhhhhheeeeepawxknnkkirvhhhoe`kkknkkkrvhhhounknnnkknnnnrqhhhhhhhhhoeeejdwxnkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkknrshhhhhoeannixw`cppdauxinkkifhhhhhhhhhhhhhoeejd`txnnnnkknknknknknbhhhhhhhhhhhhhhoeeeeeeedaunnnkknkkkwcxnnirbqhhhhhhhldnitwacawtrghhhhhhhhhhhheeeeeeejcwxrhhhhhhhhhhhheeeeeeejcwtrmhhhhhhhhhhhleeegghhhedinivhhhhhhhhhhhleeeeejcwrbqhhshhhhhhhhhhleeecrvhhoe`kknmhhhhhhhhhhhhoeeejpauinkkknrshhhhepnnkknnnkrfhhhhdniiiinnnknnnshhhhhhhhhleeejpatikkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkknkkkkkkkkkkkkkkkkkkinrshhhhhhejknixu`cpdcawtinknknfhhhhhhhhhhhhhheejpauxnnkknnknknnnknimhhhhhhhhhhhhhhleeeeeejd`tinknnknknkntnrrshhhhhhhhheuitucpdauxrfhhhhhhhhhhhleeeeeejpaurghhhhhhhhhhhoeeeeeelpcwxrvhhhhhhhhhhheeebbqhhleunnnmhhhhhhhhhhhheeeeeparbqhhvmhhhhhhhhhhleepbshhhepnnkkghhhhhhhhhhhhheeeepauxnkkirshhhhlenknnnknnnrhhhhhjixttxinknknnghhhhhhhhheeeeepawxnkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkknkkkkknnnkknrrghhhhhhoeitxxu`ddpdawwuxkkktrshhhhhhhhhhhhhhoeepcwxinkkntxuntinknrfhhhhhhhhhhhhhhleeeeeepcwxnnittnknnnnrrgfhhhhhhhhhoewwuapjjdairhhhhhhhhhhhhleeeeeejd`trmhhhhhhhhhhhleeeeeejdauxrfhhhhhhhhhhheebbqhhoeaxnnkshhhhhhhhhhhhqeeej`rbqhhorvhhhhhhhhhhleprshhhletnknkiqhhhhhhhhhhhhqeejp`tinnirvhhhhleukkniniiinrhhhhhhutuuuxinnnknrhhhhhhhhheeeeejcwxnkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkknnnxkkktnixikirvhhhhhhhopawtu`cppdcwuwuwxnktxshhhhhhhhhhhhhhhjejd`tinnkn`uw`t`nkrghhhhhhhhhhhhhhhleeeeejpcuxikutuwnknirgfhhhhhhhhhhhlj`p`djjpcwrghhhhhhhhhhhheeeeeeejcwxrqhhhhhhhhhhheeeeeeejdwtirhhhhhhhhhhhhvrbqhhoejtnnnirhhhhhhhhhhhhhvmwrrmqhhoerhhhhhhhhhhhfsrshhhleannnnnimhhhhhhhhhhhhhfcppatiirbfhhhhoewnnnixtutxighhhhhhjw`awtnnnnnnrhhhhhhhhleeeeejd`tikkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkknnkkkkininitrbvhhhhhhhhhdxwuwcppdcwtx`cutnnnrshhhhhhhhhhhhhhhqplddpcccwkxtkuntnirfhhhhhhhhhhhhhhhleeeeeejjdtnkwawtirrsfhhhhhhhhhhhhhed`adpjjcwxrmhhhhhhhhhhhoeeeeeejpauighhhhhhhhhhhoeeeeeejpcuxirhhhhhhhhhhhhhvhhhhleaxiknxtvhhhhhhhhhhhhhhvvhhhhheprhhhhhhhhhhhhvfhhhoepxiknnxxxqhhhhhhhhhhhhhqsgrrbsfhhhhhoednnkixww`uxrshhhhhhqaacauinnknighhhhhhhoeeeeeejd`xinkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkknnkkxnnirrgqhhhhhhhhhhmt``cdppc`uxwikntknirfhhhhhhhhhhhhhhhhqscawxnkkkxtktnxrrvhhhhhhhhhhhhhhhhqcpeeejc`xiitrrrbsvhhhhhhhhhhhhhhhoewcjjjjjawxrfhhhhhhhhhhhleeeeeejc`trmhhhhhhhhhhhleeeeeejdatinrhhhhhhhhhhhhhhhhhledwxinxtwshhhhhhhhhhhhhhhhhhhhelirhhhhhhhhhhhhhhhhoejuxinixtuushhhhhhhhhhhhhhhhhhhhhhhhhoecnknitu`aawtrshhhhhhhqddcwxnknnrfhhhhhhhleeeeeejd`tnnkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkknkkxrrgvhhhhhhhhhhhhhfgbuppc`uxiunirrrbsfhhhhhhhhhhhhhhhhhhhfsbrinknxxirrbsqhhhhhhhhhhhhhhhhhhqmsrrrrrrgsgmvqhhhhhhhhhhhhhhhhhhoe`djejejatxbhhhhhhhhhhhheeeeeeejcwtrfhhhhhhhhhhheeeeeeejcwxnnifhhhhhhhhhhhhhhhlejauxiiuw`wqhhhhhhhhhhhhhhhhhhlexkifhhhhhhhhhhhhhhheeauxxixww`wumhhhhhhhhhhhhhhhhhhhhhhhoedkkiixu`cca`trvhhhhhhhhmcd`tnnnrshhhhhhhleeeeeeejd`xnkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkknkkkkniinkkkngqhhhhhhhhhhhhhhhhhhqhpauxnktarvqhhhhhhhhhhhhhhhhhhhhhhhhhhhfskiaurvhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhejejeejjdddgshhhhhhhhhhhoeeeeeejpaurbhhhhhhhhhhhoeeeeeeepcuinknmhhhhhhhhhhhhhhleed`uxitu`awgqhhhhhhhhhhhhhhhhlewnnkmhhhhhhhhhhhhhheep`txxxuwa`wtimhhhhhhhhhhhhhhhhhhhhhlednnkxxu`cccauxrvhhhhhhhhhfgubrrbmhhhhhhhlejjeeeeejdwtnkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkknghhhhhhhhhhhhhhhhhhhhhj`tinkkkrhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhowkkkrhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhejjeeejjcuxrvhhhhhhhhhhhleeeeeejd`tishhhhhhhhhhhleeeeeejd`uxnnknhhhhhhhhhhhhhleejd`uttw`aawxshhhhhhhhhhhhhhheeaxnniiqhhhhhhhhhhhoeeedautttwaawuxinahhhhhhhhhhhhhhhhhhoeeunnnixuwaccawtirqhhhhhhhhhhhhvvfhhhhhhhhlepdjeeeeepcuxnnkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkrhhhhhhhhhhhhhhhhhhhhhewxnkkkkkhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhodnkkkhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhoejjeeejpauxnhhhhhhhhhhhheeeeeeejcwxivhhhhhhhhhhheeeeeeejd`tnnknkrhhhhhhhhhhleeeejdawuw`aawuxiwhhhhhhhhhhhhoeecwttxtuwhhhhhhhhhhleeejpawuw`aa`wtnnnn`ohhhhhhhhhhhhhholejxnnnxtu`cddawuxnrhhhhlllohhhhhhhhhhhhhhlee`wcjeeeejdauinkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkteeeeeeeeeeeeeeeeeeeeewxnnkkknkeeeeeeeeeeeeeeeeeeeeeeeeeeeeeepnnnkkeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeejd`tinneeeeeeeeeeeeeeeeeepauxnkdeeeeeeeeeeeeeeeeepcuxnnknknnoohhhooleeeeeeepcaaaaa`uxnnnxoohhhhhholeeejda`www`adohhhhhhoeeeeeepdaa`acawtxnnnnitplohhhhhhhhoolee`tttttu``ccdc`txinihhhel``dllohhhhhhhholeeaixwdjeeeejcwxikkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkknnnixuwadpeeeeejdwtinnnkkkkkknknnniixwapeeeeeeeeeeeeepc`txinnnnknknnkniiuwcpleeeeeeeeeeelpawxinnnnnnnnixxxxuuw`adpjjeeeeeeepcwtnknknnnniuadleeeeeeejp`tinkkknknixwdjeeeeeeejd`uinnkkknkn`peeeeeeeeeeeejpddccawtiiknniclllleeeeeeeejpccccccccpllleeeeeeeeejpdccca`uiiknknnxwajeelllleeeeepc`wwww`acddda`utnnnnglejxnxwdjeeelllleeed`knit`djeejjdauxnnkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkknknnixuwadjjeeeeejdawtxinnnkknkknnnixtu`cpleeeeeeeeeeeejpc`uuxiinnnknnnixuwapjeeeeeeeeeeeeejc`utxiniixxxxtuuw`acdppjeeeeeeeejpatxikknkkkniuapjeeeeeeejdwtnnkkkkknit`djeeeeeeejd`tnnknnknknniuapeeeeeeeeejjjdcawtinnknnixwcleeeeeeeeeejjpppdcawuucpjeeeeeeeeejjpdc`uxinkkkknitwcpjeeeeeeeeejppdcccddppdc`uxinkkkiuuxnit`djeeljjdc`iinnnnxwcpjeejpawxnnkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkknitw`cpjjeeeeeejjda`wtxnnkkknknixtuw`cpjeeeeeeeeeeeeeejpca`wutinnknnitw`cdjjeeeeeeeeeeeeejpcawwuuuuuwww``acddpjjjeeeeeeeeejd`tinnknkknnxucpeeeeeeejpcwinnkkknkiiuadjeeeeeejjawxnnkkknknknitadjeeeeeeeeejpdcwtinnknkkniu`djeeeeeeeeeeljjpdawttxuadjeeeeeeeejjpc`utinnknkkknitwcpjeeeeeeeeeejjjjjpjpdc`tixnknnnknkkkxtadjjeejpd`wuxxxxxw`djjjjpcwtinkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkknkixuacdjjjejeejejjddaawtinnkkknnxtw`acdpjejeeeeeeeejejjjjpdaa`utinnnitwacdpjjeeeeeeeeeejejjjddcaa`a`aaacccddppjjejejeeeeejjpcwxnknkknnknxwcpjeeeejejd`tinkkkkknnxuapjjeeeejjdauinknkknkkknixwcpeeeeeeeejjpa`txnknknknnnxwadjleeeeeeeejjpdawtiiitwcpeeeeeeeejpcauxinknknknknnxtwcdjjeeeeeeeeejjjjjpcawuxikikknknknnnitapjjjjjppcawuuuuwacpjjjda`txnnknkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkknntw`cdpppjjpjpjppddca`uxnnkkknixu`acddpppjppjpppjpjjjpppddcaawtxnnnxu`acdpppppppppjppjjpjppddccaccacccccddddppppppjppppjpdc`txnkkknkknnxwacpppppppdcwxinkkkknknxuacpppppppdawxinknnkknkknnxuacpjejejjjpcautinknkkknknnxxwadpjeeeejejjpd`wxinnniu`cpjeeeejjpc`utnnknkkkkkknnnxtwacppejeejejeejjpdcawuinnkkknknknkknxu`dppppddddcca```ccdpppcawxxnkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkknnxu`aaaccacccacacaaa`wtinkknkknitw`aaaacaacccccacccaccacaca``wtinnnitw`aaaaacacacaccccccacaaaa````a`aaaaaaaacccacaccdcacaawuxnnkknkknknxuwaaccccaa`wuinknkkkknnitwaaccccacawtinknknknnkknnnxu`cdpppddcawuxinnkkkkkkknnnitw`ddppjjppdda`uxikkknnxu`ddppppdcawuxnnknknnkknkknnnitu`acdppjjjjpppdc`wuxinnknkknkkkkknnit`cccaaaaaccccccacdcccawuxinkkkkkknkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkknixtuuuuuwuuuwuuuuuuttxixkkkknnixttuuuuuwuuuuwuwuuuwuwuwuuuuttxnnnnxattuuuwuuuuudauuutuuwu`uuuuuuwuuuac`cuwuawuuuwuwawwuutxxnnnkkkkknnnnxcwuuuuuuuttinnkkkkkkknnactuuuuu`ctxxii`iwikknkkknnixuw`aaa``wutxinkkkkkkkutkkknixuwaaccccaawutxnw`ikkkixu`acdccawuxinnnkkkkknknki`kknnxxuwaadccccca``wuxinnnkkkkkkknnknkkitu``wuuuuww```aaaaaa`wutxiknkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkknnixxxxxxxxiiiiiiixinnwnkkkkknnnniiiiiixixixxixixiixxxxxxxxiinnknnntiiixxxixxxxpxxixxiii`txxxxiuwixiucupixiiwixixixwiixxiinkkkkkkkkkknnniuxxiiiiuiinnkkkkkknkknntiixiiuxiatnnkdndxkknknkknnnxxtuuuuxxxinnnkknkkkkkxknkkknuxuuwwwwuuxxinnknxkkknnixuuwwuutxnnkkkkkknknkkkkxnknknnittuwawwwuuutxinnnkkkkkkkkkkkkkknnixuttxiixxttuuwwwuuuttxinnkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkknnknnnnnkninnnknnnnnkwkknknxinkntnxxinnxxnxtknnnnttnnnxxxtiknkkixnxnnnnnnnnnnuunnnnknnnwnnnnnnunnnnt`icnnnnunnknknitnnnknkknkkkiinxxknnnxxtnnniwxxxnkxixninnkkkxnnknkxnnnnknkck`nknkkknkknknnniiiiinnnkknkkknkkkkinxnkniwtuwtxututitnnkkkxnkkkknnixiutuxixknkkixnkkknxxnxkknnxxnniix`xxxxiinnnnkkkkkkkkkkkknkkkkkniininnnnnniixxxxxxiinnknkknkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkknkknknkknkknknkkkkkkkkiikkkkxxxtkkxwuxttknu`xx`kkxuxxwnkiwtxtiknxtxuwkkkkknkkknunkkkknkkiiknnnnntknkknukukkkkktkkkkkntkkkkkkkkkkkiuwxxwkkk`xxukknuxxnkkxwxwxtiknkxkkkkkiwinkkkk`kukknkkkkkkkknknnnnnknknkkkkkkkknkkutxtnknutttnntwtwxxtkkkkikkkkkknnnnx`xwxxxkkutxuxnkitxuwkkxuxiwnnnnxxnnnnnnnkkkkkkkkkkkkkkknkknknnnnknkkknknnnnnnnnnnnknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkxkkkkktwutkkktkkktkktkkknxnuixxtukkikkkxkkxkkktnnknkkknkkkkknkknkkxkkkkkkkxkkkkkkkknknkktnkkkkkntkkkkkkkkkkktkkknxnkxkkxkkkxkkkkkkukxkkxkkkxkkkkkkkktikkkknkkkkknknkkkkknkkkkknkknknknknkkkkkikkkxkkxkknnnk`ktkkxkknkxkknkwuwwwikwkxkkiknnkkkxkktkkktkkuiixtukkkkxkkkkkkkkkkkkkkkknkknkkkknkkkknknkkkkknknkkknknknkkknknkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkknkkkkkkkkkxkkkkxnkkxkkktkkkxnktkkknikwiixiinkxkkkxkkxkkkikkkkknkkkkkkkkkkkknikkknknkxknkkknkknkknknukkkkkkwkkkkkkkknkktkkknikkxkkxkkkxknkkkkwkikkxkkkxkkkkkikknxkkkkkkkknkkknknkkkkkkkkkkkkkkkkkkkkkkkkxkknxkkxknkkknwkxkkxnkknxkkkkkkkkknkwkikkikxkkkkxkkxkkkxknuxiixnkkkkxkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkknknkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkknkknikkkxkknukkkwnknxkkutknukkttkkknkkxnnkxkktnkiwkknkkkkkkkkkkkkkkkknxkkknkntkkkkkknkkkknkktkkkkkknnkkkkiukkkkttkntkkkxkkikkktkkknkkukxkkxkkkxkkkkkttxxkkkknknkkknkkkkknknkkkkkkknwiknkknkkkkkkxkkkxkkinknnkkwkikkinkkkxnknkkkkkkkkukikkikktnknxkktnkiwkktxkkknknktkkkkkkknknkkkkkkkkkkkkkknknkkkkkkkknkknkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkktkkknuuixtkkituxkkkinutnkkkiuwiknxuikxukkktuxnwkkknknknkkkknkkkkkkukknkkktnkkkkkknkkkkkkntkkkkkkukkkkiukkkkinutnkkuuknuukkkuwuikuukxnkukxuuwuikkkkiknkkknkkkkkknkknkkkkkkkkkkknunkknkkkkkknxunkuuikkxwuxktuinxkxinwuuutkkkkkkkktuinxkxnkkuuxkkkkuuxnukknuuiknkkukkkkkkkkkkkkkkkkkkkknkkknkkkkknknkkkkkkkkkkkkkkkkkknknkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkknkkkkknnkkkkkkkkkkikkkkkkikkkkknkkkknkkkkkknkkkkkkkknkkkkkkkkkkkkknkkkkkniknknkkxkkkkkkkknknkkknnkkkkkikkkkkkkkkkxkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkknknkkknkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkknkkknkkkkkkkkkkkkkkknknkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkxnkkkkkkkkkkknkkkkkkkkkkkkkknknkknkkkkknkkkkkkkknknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkuwtkkkkxwuknkkknkkkkknkkkkkkkkkkkkkkknkkknkknkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkxwunkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkknknkknkkkkkkkknkkkkkkkknkkkkkkkkkkkknknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkknkkkkkkkkkkkkkkkknkkknkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknknkkkkkkkkkknknkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkknkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkknknkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkknkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkknkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkknkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkknknknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkknkknkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknkkkkkkkkkkkkknkkknknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkknknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkknkknkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkknkkkknkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkknkknkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkknkkkkknkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkknnkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkknkkkknkkkkkkkkkkkkkkknknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkknkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkknknknktixikkkxkkkkkkinkkkkkkkkkkkkkkkkkkknxkkkkkkkkkkkkkkkkkkkkknxnkkkkkkikkkkkixnxkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkktikkkkkkkkkkkkkkkkkkkkktxkkkkknkkkkkkkkkkkkkkkkkkkkkkkkinkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkknkkkkkkkkkkkkkkkkkkxnkkkxixtkkkknkkkkkkikkkkkkkkkkkkkkkkkkkknkkkkkkknkkkkkkkkkkkkkkknkkkkkikkukkkntnukkkkkkkkkkkkkkkkkkkkkkknkkkknkkkknkkkkkknkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkknkkkkkkkikkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkikkkkxnixkkkkikkkkkkiknkkkkkkkkkkkknnnkkknknkkkkninnkkknnnknkkkkknkkkkknkkkkkknxktkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkinikkkninnnkkininnnkkkknkkkkkkkkkkkiniknnkkkknikkkkknnknkkkknkkkkkkikkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkknnkkknnnnnkkkkknkkkkkkikkkkkkkkkkknxnninkkninnnkkninnkkkinninikkkknkkkkkninkkkkkikikkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkxnnikkninnnkknxnxninkkknkkkkkkkkkkknxnxnnnkkxnnxnkkinnxnkkinniikkkknkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkikkkkkkikkkkkkkkkkknnnnnxkknkkknkkknkkkkknnknknkkkknkkkkkkkkikkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknkkknkkkkkkxknkknkkknkkkkkxxxxxkkxknkknknkkkknknkkkknkkinnnikkkknkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkknkkkkkkkikkkkkkkkkkinnnnnkkkkkknkkknkkkkknnknknkkkknkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknkkknkkkkkkiknkknkkknkkkkkkkkkkkkiknkknknkkkknknkkkknkkinnnnkkkknkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkknkkkkkknkkkkkiikkkkikkkkkknkkknkkknkkkkknkkkkkkkkknkkkknninkkkkkkkkkkkkkkkkkkkkkkkkkkkkikkkkkkkkkkkknkknkkknkkkkkkiknkknkkknkkkkkkkkkkkkiknkknknnkknkkknkknnkkxkkkkkkkknkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkknkkkkkkknkkkknnkkkkkiinkkknnknnnkkkinnkkinkikknkninnikkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkknikkkkkkkkkkkiikkiikkkninkkiiknnkiknninikkkkkkkkkinknkkikkkiinkkkkinnnnkkniikkkkknkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk"
-};
Add a comment to this file

etc/xemacs.xpm

Old
Old image
New
New image
 /* width height ncolors chars_per_pixel */
 "388 145 25 1",
 /* colors */
-"` c #686869",
-"a c #A6AAF5",
-"b c #585859",
-"c c #797979",
-"d c #09090B",
-"e c #989CEA",
-"f c #383839",
-"g c #363ACC",
-"h c #282829",
-"i c #88888A",
-"j c #13154C",
-"k c #7074DF",
-"l c #5256D8",
-"m c #484949",
-"n c #232788",
-"o s None c None",
-"p c #B8B8B9",
+"` c #787879",
+"a c #686869",
+"b c #A6AAF5",
+"c c #585859",
+"d c #484849",
+"e c #09090B",
+"f c #5256D7",
+"g c #989CEA",
+"h c #363ACC",
+"i c #C7C8CF",
+"j c #282829",
+"k s None c None",
+"l c #13154C",
+"m c #7074DF",
+"n c #D9D9DB",
+"o c #232788",
+"p c #383838",
 "q c #4249D0",
 "r c #B6BAF9",
 "s c #868AEB",
 "t c #A8A8A9",
-"u c #C8C8CF",
-"v c #989899",
-"w c #6266DB",
-"x s None c None",
+"u c #989899",
+"v c #6266DB",
+"w c #888889",
+"x c #B9B9B9",
 /* pixels */
-"xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx",
-"oxxoxxoxxoxxoxxoxoxoxoxxoxxoxxoxxxxoxxoxxxoxxoxxoxxoxxoxoxxoxxxoxxoxxoxxoxxoxoxxoxxoxxxoxxoxxoxoxoxoxxoxxoxoxoxxoxxoxoxoxoxoxoxxoxxoxxoxxoxxoxxoxoxoxoxxoxxoxxoxxxxoxxoxxxoxxoxxoxxoxxoxoxxoxxxoxxoxxoxxoxxoxoxxoxxoxxxoxxoxxoxoxoxoxxoxxoxoxoxxoxxoxoxoxoxoxoxxoxxoxxoxxoxxoxxoxoxoxoxxoxxoxxoxxxxoxxoxxxoxxoxxoxxoxxoxoxxoxxxoxxoxxoxxoxxoxoxxoxxoxxxoxxoxxoxoxoxoxxoxxoxoxoxoxxoxoxoxoxoxoxoxxoxx",
-"xxxxxxxoxxxxxoxxxxxxxxoxxxxxxxxxoxxxoxxxoxxxxxxxxoxxxxxxxoxxxoxxxxxxxxxxxoxxxxoxxxxxxoxxxxxoxxxxxxxxoxxxxxxxxxoxxxxxxxxxxxxxxxoxxxxxxxxoxxxxxoxxxxxxxxoxxxxxxxxxoxxxoxxxoxxxxxxxxoxxxxxxxoxxxoxxxxxxxxxxxoxxxxoxxxxxxoxxxxxoxxxxxxxxoxxxxxxxxxoxxxxxxxxxxxxxxxoxxxxxxxxoxxxxxoxxxxxxxxoxxxxxxxxxoxxxoxxxoxxxxxxxxoxxxxxxxoxxxoxxxxxxxxxxxoxxxxoxxxxxxoxxxxxoxxxxxxxxoxxxxxxxxxxxoxxxxxxxxxxxxxxoxxxx",
-"oxxoxxxxoxoxxxxxoxoxoxxxoxxoxxoxxxoxxoxxxxoxxoxxxxxoxxoxxxxoxxxxxxxxxoxxxxoxxxxxxxoxxxxxoxxxxoxoxoxxxxoxoxxoxxxoxoxxxoxoxoxoxxxxoxxoxxxxoxoxxxxxoxoxoxxxoxxoxxoxxxoxxoxxxxoxxoxxxxxoxxoxxxxoxxxxxxxxxoxxxxoxxxxxxxoxxxxxoxxxxoxoxoxxxxoxoxxoxxxoxoxxxoxoxoxoxxxxoxxoxxxxoxoxxxxxoxoxoxxxoxxoxxoxxxoxxoxxxxoxxoxxxxxoxxoxxxxoxxxxxxxxxoxxxxoxxxxxxxoxxxxxoxxxxoxoxoxxxxxoxoxxoxxxxxxxxoxoxoxoxxxxxoxx",
-"xxxxoxxxxxxxxxoxxxxxxxxxxoxxxxxoxxxxxxoxxxxxxxxoxxxxoxxxoxxxoxxoxxxxxxxxxxxxoxxxoxxxxxoxxxoxxxxxxxoxoxxxxoxxxxxxxxxoxxxxxxxxoxxxxxxxoxxxxxxxxxoxxxxxxxxxxoxxxxxoxxxxxxoxxxxxxxxoxxxxoxxxoxxxoxxoxxxxxxxxxxxxoxxxoxxxxxoxxxoxxxxxxxoxoxxxxoxxxxxxxxxoxxxxxxxxoxxxxxxxoxxxxxxxxxoxxxxxxxxxxoxxxxxoxxxxxxoxxxxxxxxoxxxxoxxxoxxxoxxoxxxxxxxxxxxxoxxxoxxxxxoxxxoxxxxxxoxoxxxxxxoxxxoxoxxoxxxxxxxxoxoxxxxx",
-"xoxxxoxxxxoxoxxxxxxoxoxoxxxxoxxxoxxoxxxxxoxxoxxxoxxxxxxxxxoxxoxxoxxxxoxxxxxxxoxxxxoxxxxxxxxxxxoxoxxxxxxoxxxoxxoxxoxxxxxxxoxxxxxoxoxxxoxxxxoxoxxxxxxoxoxoxxxxoxxxoxxoxxxxxoxxoxxxoxxxxxxxxxoxxoxxoxxxxoxxxxxxxoxxxxoxxxxxxxxxxxoxoxxxxxxoxxxoxxoxxoxxxxxxxoxxxxxoxoxxxoxxxxoxoxxxxxxoxoxoxxxxoxxxoxxoxxxxxoxxoxxxoxxxxxxxxxoxxoxxoxxxxoxxxxxxxoxxxxoxxxxxxxxxxoxoxxxxxoxoxxxxoxxxxxxxxxxxxoxxxxxxoxox",
-"xxoxxxxoxxxxxoxxxoxxxxxxxxoxxxxxxoxxxoxoxxxxxxxxxxoxxoxxxxxoxxxxxoxxxxoxxoxxxxxxxxxxoxxxxxxxoxxxoxoxxoxxxxxxoxxxxxxxxxxoxxxoxxxxxxoxxxxoxxxxxoxxxoxxxxxxxxoxxxxxxoxxxoxoxxxxxxxxxxoxxoxxxxxoxxxxxoxxxxoxxoxxxxxxxxxxoxxxxxxxoxxxoxoxxoxxxxxxoxxxxxxxxxxoxxxoxxxxxxoxxxxoxxxxxoxxxoxxxxxxxxoxxxxxxoxxxoxoxxxxxxxxxxoxxoxxxxxoxxxxxoxxxxoxxoxxxxxxxxxxoxxxxxxxxxxxooxoxxxxoxxxxoxxxoxxxxxoxxxoxxxxxxxx",
-"xxxxxoxxxoxxxxoxxxxxoxxoxxxxxxoxxxxoxxxxxxxxoxxxoxxoxxxxoxxxoxxoxxxxxxxoxxxxxoxxxxxxxxxxxoxxxxxoxxxxxxxoxoxxxxoxxoxxoxxxxxxxoxxoxxxxxoxxxoxxxxoxxxxxoxxoxxxxxxoxxxxoxxxxxxxxoxxxoxxoxxxxoxxxoxxoxxxxxxxoxxxxxoxxxxxxxxxxxoxxxxxoxxxxxxxoxoxxxxoxxoxxoxxxxxxxoxxoxxxxxoxxxoxxxxoxxxxxoxxoxxxxxxoxxxxoxxxxxxxxoxxxoxxoxxxxoxxxoxxoxxxxxxxoxxxxxoxxxxxxxxxxxoxxxxoxxxxxoxoxxxoxxxoxxxxxoxxxxxxxoxxxxoxx",
-"xoxoxxxxxxxoxxxoxxxxxoxxoxxxoxxxoxxxxxxxxoxxxxxxxoxxoxoxxxxxxoxxoxxoxxxxxxxoxxxxxxxxxxoxxxxxxxxxxoxoxxxxxxoxxxxxxxxxxoxxxxxxxxxxxoxxxxoxxxxoxxxoxxxxxoxxoxxxoxxxoxxxxxxxxoxxxxxxxoxxoxoxxxxxxoxxoxxoxxxxxxxoxxxxxxxxxxoxxxxxxxxxxoxoxxxxxxoxxxxxxxxxxoxxxxxxxxxxxoxxxxoxxxxoxxxoxxxxxoxxoxxxoxxxoxxxxxxxxoxxxxxxxoxxoxoxxxxxxoxxoxxoxxxxxxxoxxxxxxxxxxoxxxxxoxxxoxxxxxxoxxxxoxxxxxxxxoxxxxxxxxxoxxox",
-"xxxxxoxoxoxxoxxxoxxxxxxxxoxxxxoxxxxoxxxxxxxxxxxxxxoxxxxxxoxoxxoxxoxxoxxxoxxxxoxoxxxxxxxxxxxxoxxxxxxxoxxoxxxoxxoxxxxxoxxoxxxxxxxxxxxoxxxxxoxxoxxxoxxxxxxxxoxxxxoxxxxoxxxxxxxxxxxxxxoxxxxxxoxoxxoxxoxxoxxxoxxxxoxoxxxxxxxxxxxxoxxxxxxxoxxoxxxoxxoxxxxxoxxoxxxxxxxxxxxoxxxxxoxxoxxxoxxxxxxxxoxxxxoxxxxoxxxxxxxxxxxxxxoxxxxxxoxoxxoxxoxxoxxxoxxxxoxoxxxxxxxxxxxxxxxxxxxoxxxxxxoxxxxoxxxxoxxoxxxxxxxxxxxx",
-"xxoxxxxxxxxxxxoxxxoxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxoxoxxxxxxxxxxxxxxxxoxxxxxxxxoxoxxxxxxxxoxxxoxxoxxxxxxoxxxoxxxoxxxxxxxoxxxxxxxxxxxoxoxxxxxxxoxxxoxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxoxoxxxxxxxxxxxxxxxxoxxxxxxxxoxoxxxxxxxxoxxxoxxoxxxxxxoxxxoxxxoxxxxxxxoxxxxxxxxxxxoxoxxxxxxxoxxxoxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxoxoxxxxxxxxxxxxxxxxoxxxxxxxxoxoxxxxxxxxxxxoxxxxxxxoxoxxxoxxxxoxxxxxxxoxxxxxxxoxxx",
-"xxxoxxoxuuxoxxxopxxxxxxxxxuuxxxxoxxxoxxxxxxxxxoxuuoxxxoxoxxxoxoxopoxxxxxoxxxooxxxxxxxxxxxxxxoxxxxxxxoxxxxxxxxxoxxxxxoxoxxxxxxxxxxxxxxpoxoxxxoxxxxxxxxxxpoxxxxxxxoxxxoxxxxxxxxpooxxoxxxoxoxxxoxxoxxxxxxxxoxxxooxxxxxxxxxxxxxxoxxxxxxxoxxxxxxxxxoxxxxxoxoxxxxxxxxxxxxxxxxxoxxxoxxxxxxxxxxxxxxxxxxxoxxxoxxxxxxxxoxoxxoxxxoxoxxxoxxoxxxxxxxxoxxxooxxxxxxxxxxxxxxxxxxoxoxxxxxxxxxoxoxxxxxoxoxxxxxxxxxxoxx",
-"xxxxxxxxxoxxoxxxuxxxxxxxxxxuxxoxxxxxxxxoxxxxxxxxxuxxoxxoxxxxxxxoupxoxxupppxxxxxxxxxoxpptpuuxxxoxxxxotuxotuxxoxxxoxxxxxxoxxxxxxxxxxoxxxuxoxxxxxxxoxxxxxxxuxxxxoxxxxxxxxxoxxxxxxuxxxxoxxoxxxxxxoxxoxxxoxxxxxoxxxxxxxxoxxxoxxxxxxoxxxxxxxoxxxxoxxxxoxxxxxxoxxxxxxxxxxoxxxoxoxxxxxxxoxxxxxxxxxxxoxoxxxxxxxxoxxxxxxxxoxxxoxxoxxxxxoxxoxxxoxxxxxoxxxxxxxxoxxxoxxxxxxoxxxxxxxxxxxxxxxxxoxxxxxxoxxoxxxxxxxxx",
-"xoxxoxooxoxxxouooxxxxxxxxxxooooxooxouoxxoxxuuxoxxuxouuxxoxxxxoxxtuxxxxxxuxxxxxxouoxxxoxoxxoxxxuuooxxopxuoxxxxxxxxooouxuoxoxouoxxxxxooxuxxxuuoxxxxxxxxxxxuouxxxxxuuoooxxouoxoxxuxuuoxoxxoxxxxxxoxxoxxxoxxoxxxxxxxxxxxxxxxxxxxxxxxoxxoxxxxxxxxxxxxxxxxxoxxxoxxoxxxxxxxxxxxxxoxxxxxxxxxxxxxoxxxxxxxooxooxxxoxxxxxoxxoxoxoxxxxxxxxoxxoxxxoxxoxxxxxxxxxxxxxxxxxxxxxxxoxxoxoxoxxxxxxxxxxxxxoxxxxxoxoxxxoxx",
-"xoxxxuoouuoxuuoppxxxxxxxxxopuuuoxxupuppxxopuupooxuxpuoxxxoxxxxxopxxxxoxxuxoxooxouuoxxxxuxxxxxpuuuuxoxuupxxxxxxxxxopuupupxxupuupxxxpuupoxopuupuxxxxxxxxxxtuupxxxpuopuxoupuupxxxuxtuoxoxxoxoxxoxxoxxxxxxxxxxoxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxoxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxooxxoxxoxxxxxxxxoxoxoxxoxxoxxxxxxxxxxoxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxoxxxxoxxxxx",
-"xoxxoxoxxuxxuxxxuxxuptptuxxuxxxuxxuxxxooouxxxxuxxutoxoxoxxoxxxxxxxoxxxxxuxxxxooppuoxxxxoxxxxuuouutxxxotoxxxutptpuxuuxuxuxxuxxoxuxuxxxouxuuuuotxxppptpoxxoxxuxxooxxxuxxuxxoxuxxppoxxoxxxxxxoxxxxxooxxxxxxoxxxxoxxxxxxxxxxxxxxxxxxxxoxoxoxxxxxxxxxxxxxoxxoxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxoxxxxxooxoxoxxxxxxoxxxxxooxxxxxxoxxxxoxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxooxxxxxoxxxxxoxx",
-"xoxxoxxxxoxxoxxxuxxxxxxxxxxuxxxuxxuxoxouxuxoxxuxxuotxoxxxoxxxxxxoxoxxxoxuxxuxxpoxouxxxxuxxxxpuuouuxxxtxpoxxxxxxxxouuxuxuxxuxxxxuxuxxxxuxpuouuuxxxxxxxxxxuxxuxxuxxxxuxxuoxxxuxxpuuxxxooxoxoxxxxxxxxoxoxoxoxxoxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxooxxoxxoxxxxxoxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxoxoxxoxxxxxxxxooxooxoxxxxxxxxoxoxoxoxxoxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxooxxxoxxxxxxoxoxxox",
-"xoxxoooxuuxxuoxotxxxxxxxxxxuxxxuxxpuxopxoopxxpoxxuxopxxxoxxxxxxoxxxoxxxouoouxxuoxuuxxxxuxxxxotoxxoxxpoxotxxxxxxxxxuuouxuxxuuxopoxuuxopuxotoxxxxxxxxxxxxxuxxuxxxpoxopoxpoxotxxxuxuuxxxxxxxxxxxxxoxoxxxxxxxxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxoxxxxoxxxoxxxxxxoxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxoxxxxxxxxxxxxxxxxxxxoxoxxxxxxxxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxoxxoxxxxxoxxxxx",
-"xooxxxuuouuxxppuotxxxxxxxxutoxttoxxpttoxxxuttooxppxxttoxxxoxxxxxoxxoxxutttttxxuttotuxxpttuxxxxptpoxotuxotpxxxxxoxutpxtoupxopttoxxxutpotoxoptpxxxxxxxxxxttxottxxoptpxxxoptpooxtuxotpxxoxoxxoxxxxxxxxoxxxoxxxxxxoxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxoxoxxxoxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxoxxxxxxxxxxxxxoxxoxxxxxxxxxoxxxoxxxxxxoxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxoxxxoxoxxxxoxxx",
-"xxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxoxxoxxoxxxxxxoxxoxxxxoxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxooxxxxxxxxxxxxoxxoxxoxxxxxxxoxoxxoxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxoxoxxxxxxoxxoxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxoxoxxxoxxoxxxoxxoxxoxxxxxxxoxoxxoxxxxoxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxoxxxxxxxxxoxoxxoxx",
-"xoxxxxxxxxoxxxoxxxxxxxxxxxxxxxxxxxxxooxxxxoxxxxxxxxoxxxxoxxoxxxxoxoxxxxoxxxxoxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxoxxxxoxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxoxoxoxxxxxxxxoxxxxooxoxxxxoxoxxxxoxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxoxxxxxxxxxxoxxxxooxoxxxxoxoxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxoxxxxxoxxox",
-"xxxoxxoxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxoxxxxoxoooxxxxxxxxoooxxxxxxxxxxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxoxxxxxxxxxxxoxoxxoxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxoxxooxxxxxxxxxoooxxxxxxxxxxooxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxoxoxxxxxxxxxxxxoxoxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxoxxoxxxxxxoxxxoxxoxoxxxxxxxxoooxxxxxxxxxxxoxoxxxxxxxxxxxxxxxxxxxxxxxxxoxoxxoxxxxxxxxxxxoxxxxxx",
-"xoxxoxxxxxxxoxxxxxxxxxoooxxxxxxxxxxxoxoxxooxoxxxxoxoxxxxxxxxxxxxxxxoxoxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxoxxxxxxxxxxxxxxxooxxxxxxxxxoxxxxxxxxxoooxxxxxxxxxxxxxooxxoxoxxxoxxxoxxxxoxxxxxxxxxoxoxxoxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxoooxxxxxxxxxxxoxoxxxooxxxxxxxxoxxoxxxxxxxxxxxoxoxxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxoxxoxxxxoxxxxoxoxx",
-"xxxxxxoxoxxxxxoxxxxxxxxxxoxoxxxxxxxxxxxooxxxxxxxxxxxxxxoxoxxxxxoxoxxxoxoxxoxxxxxxxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxoxxxxooxxxxxxxxoxxxxxxxxxxooxxxxxxxxxxxxxoxxxxxxxxxxxxxxoxxxxxxxoxoxxoxoxxxoxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxoxxxxoxxooxxxxxxxxoxxxxxoxxxxoxoxxxxxxxxxxxxoxxxxxxxoxxxxxoxxxxxxxxoxoxxoxoxxoxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxoxxxxxxxxoxxxoxxx",
-"xoxoxxxxxxxoxxxxxxxooxooxoxxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxoxoxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxoxoxoxxxxooxxoxxxxxxxxxxxxxxooxoxxoxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxooxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxoxxxoxoxoxxxxxoxxoxxxxxxxxxxxxxxxooxooxxoxoxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxoxooxxxoxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxoxxxoxoxxoxxxxox",
-"xxxxoxoxxxxxooxooxxxxxxxxoxoxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxooxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxoxxxxxooxxxxxxxooxooxxxxxxxxoxoxxxoxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxoooxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxoxoxxooxxxxxxxooxooxxxxxxxxoxoxxxxoxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxoxxooxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxoxxx",
-"xoxxxxxoxxxxxxxxxxxxxxoooxoooxoxxoxoxxxxxxxxxxxxxxxxxxxxxxxxooxxxxuxxxiixooxxxxxxxxxoxxxxxovxxxxxxxxxxupxxxxxxxxxxxxxxoxxoxxuxxxxuxxxxoxxxxxxxoxxxxxxxoooxxooxoxooxoxxxxoxxxxxxxxxxxxxxxxxxxooxxxxoxxxooxooxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxoxxxxxoxxxoxxxxxxxoxxxxxxxooxxoooxoxxooxxxxxxxxxxxxxxxxxxxxxxxxxooxxxxxxxxooxooxxoxxxxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxoxxoxoxxoxx",
-"xxxoxoxxxxxxxxxooxxoxxxxxoxxoxooxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxvoxxxxpxxxxoxxoxoxxxxxxxxxuxxxxxxxxxxxuxxxoxxxxoxxxoxxxoxxovoxxxvxoooxoxxxxxxxxooxxxxxxxooxxoxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxoxxxxoxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxoxxxoxxxoxxxxxxooxoxxxxxxxxooxxxxxxxoxxoxooxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxoxxxoxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxoxoxxxxxxoxxxxxxxox",
-"xoxxxxooxxxxxxxxoxxxoxxxxxxxxxxoxoxxxxxxxoxxxxxxxxxxxxxoxxxxxxxxxvxxxxxtooxxoxppoxxpupoouxxpxouxxxxxuuxpxxxupuxxxxoxxxxxxxxpuxxxouuxxxxoxxxxxxxxoxxxooxoxxxoxxxxxxoxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxoooxxoxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxooxxxxxxxxxxxxoxxoxxxoxxxxxxxxoxxxooxooxxxxxxoxxoxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxoooxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxoxxxxxoxoxoxxx",
-"xxxxoxxxxxxxxxxoxxxoxoxooooxooxxooxxxxxxxxooxxxxxxxxxxxoxxxxxxxxuoxoxxxpxxxxxuppvoxpipiptuxpvtpixxxvupipxxopptuxxxxoxoxxxxxtxxxxxxtxxxxxxxxxxxoxxxxoxxxooxoxooxxooxxxxxxxoooxxxxxxxxxxxoxxxxxxxxxxxxxxxoxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxoxxxxxxxxxxxxxxxxxxxxxxoxxxoxxxxxoooooxxooxxxxxxxxooxxxxxxxxxxxoxxxxxxxxxxxoxxxoxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxoxxxxxxxxxxx",
-"xoxxxxoxoxoxxxxxooxxxxxxxxxxxoxxxxxxxxxxxoxxxxxxxxxxoxoooxxxxxxxpxxxxxxpooxoxuiivxxxixpxxpxpoxxxtxuxxxxtxxxvitpxxxxxxxoooxxpoxoxxopoxoxxxxxxxxxxooxxxxxxxxoxxoxxxxxxxxxxxxxxxxxxxxxxoxoooxxxxxxxxxxxxxxxooxoxoxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxoxxxoxoxxoxxxxoxxxxxxxxxooxxxoxxxxxxxoxxxxxxxxxxoxxxxxxxxxxxoxoooxxxxxxxxxxxxxxxooxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxoxoxxoxxxoxo",
-"xxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxpxxxxxopxoxoovxxtoxoixpxxpxpxxxxpxpxxxxuxxtoxopxxxxxxxxxxxxpoxxxxxpxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxoxxxoxxxxxoxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxoxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxoxxxxxxxooxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxoxxoxxxx",
-"xoxxxoxxoxoxxoxxxxxxoxxxoxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxoxxoxpxxxxotxxxxpoxxixoxcxpxxpxpvoxuuxovxxtvxxtxxppxxxxxxxxxoxxtxxxxxopxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxoxxxxxxooxxoxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxoooxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxoxoxxxxxoxxx",
-"xxxoxxoxxxxoxxxxxoxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxoxxxvoxopccccuxxviipixcixvuxcuiociuxxxxicuttxpiioiuxxxxxxxxxxxuvxoxovuoxxxxxxxoxxxxooooouoooooxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxoxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxoxoooxxxxxxxxoxxxxoxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxoxxxxxxoxxoxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxoxoxxox",
-"xoxxxxxoxoxxoxxoxxxoxxxxxxxxxxxxxuururuurrrruururrurururrrrrrrruxuuoxxxxurrrrrrrrrrrrrrrrrrruxxxxxxxxrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrssssssssseaxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxoxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxoxoxxxxxooxoxooxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxoxxoxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxoxxxxxxoxxxxox",
-"xxoxoxxxxxxxxoxxxxxxxxxxxxxxxxxxxrgqggggqgqgggggqggqggggggggggggkxxxxxxxrwgggggggggggggggggggkxxxxxxxrggggggggggggggggggggggggggggggggggggggggggggggqggggggqtxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxoxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxoooxxxoxxxxxxxoxoxoxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxoxxoxxoxoxxx",
-"xxxxoxoxxoxoxxoxoxxxoxxxxxxxxxxxxuggggggggggggggggggggggggggggggnmxxxxxxowgggggggggggggggggggnmxxxxxxogggggggggggggggggggggggggggggggggggggggggggggggggggggndxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxoxxxxoxxxoxxooxxxxxxxxxxooxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxoxxxoxxxooxxxxoxxoxxxxoxx",
-"xxoxxxxxxxxxoxxoxxxxxxxxoxoxoxxxxxknggggggggggggggggggggggggggnnjmxxxxxxxegnggggggggggggggggnjmxxxxxxxkngggggggggggggggggggggggggggggggggggggggggggggggggggjmoxxxoxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxooxxxxxxxxxoxoxxxxxxxxxxxxxxxxxxxoxxxxxxxxoxxooxxxxxxoxxxxoxxxxoooxxxxxxxxxxxxxoooxxxxoxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxoxoxxxxxxxxxxxxxxxxxxxooxxxxxxxxoxoxxxxxxoxxox",
-"xxxxoxoxoxxxxxxxoxxxxxoxxxxoxoxoxoxbfjjgggggggggggggggggggnjddfmmcxoxoxxxximmmqggggggggggnjddfcxoxxxxxxmmjdnqggggggggggggggggggjdddddddjjnnggggggggggggggggjcoooooxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxoxxxxoxxxoxxxxxxxxooxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxoxxxxxxxx",
-"xxoxxoxxxoxoxxxxxxxxxxxxxxxxxxxxxxxxxopclggggggggggggggggjdmtooooouooooooxxxxosgggggggggjdf`ououoooxxxxxxxxueggggggggggggggggndjcpuuuouviimfjngggggggggggggdiuuuuooxxxxxxxxxxooxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxoxooxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxooxxxxxxxxxxxxxxxxxxoxoxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxoxx",
-"xxxoxxoxxxxxxoxxxxxoxxxxxxxxxxxxxxxxxoxuokgggggggggggggggjmpppupuppptpuuoxxxxusggggggggdd`ppppppppuuuoxxxxxouwgggggggggggggggdhpppuppppppppppcmnggggggggggndtptpppuoooxoxxxxxooxooxxxxxxxxxxxxxxxxxooooxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxoxoxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxoxxxxxooxooxxxxxxxxxxxxxxxxxooooxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxoxoxxxxoxxox",
-"xoxxxxxxoxoxxxoxxxxxxxxxxxxxxxxxxxxxxxxourlggggggggggggggdbiiiiiivvvvvtpuoxxxrwggggggnddciiiiiivvvttpuoxxxxorwggggggggggggggndciiviiviiviiiviviimqggggggggjhciciivpuooxxxxxxxxoxooxoxxxxxxxxxxxxxxxxooxxxxxxxxxxxxxxxxxxxxoooxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxoxxoooxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxooxoxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxoooxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxoxxxxxxx",
-"xxoxxoxxoxoxoxxxxxoxxxxxxxxxxxxxxxxxxxxoptkggggggggggggggjbbbbb`b```ccvppuoxuaggggggndhm`bb`b`b`b`citpoxxxxorwggggggggggggggjjbbbbbb``b``````````bqgggggggjhmbmb`cvpuxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxoxoxooxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxoxxoxxoxox",
-"xxxoxxoxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxoopvaggggggggggggggjhhfhfffmb``cituoxurlgggggnddjhfhfhfffmmb``mbtxxxpurgggggggggggggggdhhfhffffhfbbbbbbbbbmmwqggggggddhhhhf`ipuxxxxxxxxxxxoxxxxxxxxxxxooxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxvtxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxoxxxxx",
-"xoxxxxxoxoxxoxxxxxxxxxxxxxxxxxxxxxxxxxxopvvwgggggggggggggndddhdhfmm`civtuoorkgggggndhfhdhdhdhhhfbbcbpuxxxxuurggggggggggggggndddhddhhfmfb``````bbbmmkggggggdddddhhb`bm`oxxxxxxxxxov``b`bxxooxxoxxmbxxbcxxxxxoxxxxxxxxxxxxxxxxxxxxxxpxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxoooxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoooxxxxxxooxoooxxoxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxx",
-"xxxxoxxxxxoxxxooxxoxxxxxxxxxxxxxxxxxxxxooptsggggggggggggggdddddhfbcivtpuuursgggggndhmmfddddddhfb```bvtxxxttusggggggggggggggjdddddddhfbbi``cvii`bb`bsqggggnddddddfbitvoxxxxxuttxxxtoxvxtxxxpvpoooomxocoxxxxxxxxpopxuoxxxxtuxxxxxppxuxxxotoxxxxxxxxxxpupxtoxxxutuxootxttoxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxoxxxxxxooxxoooxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxoxxxoxx",
-"xxxxxoxoxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxoouurggggggggggggggddddhfbcvtppuoouegggggndfbbfhdddddhhfcvii`vpxxxtcrkggggggggggggggjddddddhfbc`tbcippb`cbbiikggggjdddddhfbipvxxxxxxtttioxxxxtxxxocivicxxxuc`xxxxxxxxxxt`t`tvuxx`tpcxxxipt`vxxivtiixxxxxxxxxcvvipcxxuttvuxuicvtcpxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxoxooooxoxooxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxx",
-"oxoxxxxxxxoxxxxxxxxoxxxxxxxxxxxxxxxxxoxoxxouwgggggggggggggjdddhf`ituuuooraqggggndmiui`fhdddhhmhvpuuvoooxxxtrlggggggggggggggddddddddfcvcbtooop`vvimvtsggggddddddhf`vpvoxxxxxvbcvxxxxxtxxxucttvbpooo`iooxpc``bcxx`xpxxpxpxxxxpxtoxxxvxucttt`uxvc`ccvxttxvxtxxocbvtxxvoxxxixxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxoxxxxoooooxoxooxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxox",
-"xxxoxoxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxoxooxxokgggggggggggggndddhfctpoxxxraqgggggdmovpibfdhdhfm`cpuootoxxxoxarggggggggggggggnddddddhfbvpcp`ooxpcvvtvpueggggdjddddhf`tpvoxotxtpooixxxxxvxxxpcvvttoxxipttxxxxxxxxxx`xpxxpxtxxxxtxtxxxxtxpcttvtoxxxoxxxxptxtotxxvxxxtxxtuxxxvxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxoooxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxooxoxxxxxxxxxx",
-"oxxxxxoxoxoxxxoxoxxxxoxxxxxxxxxxxxxxoxxxoxxxrggggggggggggggdddhmctuooxraqgggggddooicimhdhhh`vttoooxvxxxxxxasggggggggggggggjddddddhmctuvxucxoxbpxouxxrgggndfhdddhmctuvxxxvxixxocxxxxxtxoxobuxxxxxttxx`oxxxxxxxxx`xpxxpxotxxvuxocxoicxxbpooooxxxxxxxxptxtovoovxxtuxxtcoxipoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxooxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxoxxoxxxoxx",
-"xoxxxxxxxxxoxxxxxxoxxxxxxxxxxxxxooxoxooxxxooulgggggggggggggjddhmctoxxuaqggggnddooop`hhhdhm`mmcuooibbbixxtbrkggggggggggggggdddddddfbvpcioxbbxxxibcpoxrgggndbhhddfbcvbbbbbuxubbtiixxtb`booxxibcpxx``xx``xxxxxxxx``xvuxcxxu``pxxxobbpiixxi`cpxxxxxxxxobix`opixvbbubpxpocbuxxoxxxxxxxxxxxxxxxxxxxxxxxoxooxoxxxooxxxxxxxxxxooxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxoxxxxx",
-"xxoxxxxoxoxxoxoxxxxxxxxxxxxxxxoxxooxxxooxxxxokgggggggggggggnddhf`vpoorlgggggdjvpoutcbfhfmcvtuxxxooxxxxxxxorqgggggggggggggnddddddhf`vpoxxxxxoxoxxxxxxrgggjmcmhdhfbitooxooxxxxxoxxxxxxxxxxxoooxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoooxoxxxxxxxxxxxxxxxxxxxxoxxxxxxxxtxxxxxxxxoxoxxxxxxxxxxxxxxxxxxxuoxxxooxxxxxoxxxxxxxoxxxooxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxooxoxxxxxxxxxxxxxxxxxxxxoxoxxxoxoxx",
-"xxxoxxxxxxxxxxxxoxxoxxxxxxxxxxoxxxooxoxoxxxxxaggggggggggggggdddfbvprrwgggggdjuxoptibfffb`ituoxxxxoxooxxxxoaggggggggggggggndddddddm`voxxxxxxxxoxxoxxoegggdcibfhhf`ttuooxxoxxxxxxxxoxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxoxxxxxxxxxxxxxxxxxxxxxxxxxxpmbpxxxxxxxxoxxoxxxxxxxxxxxxooxxxooxoxoxxxxxxxxxoxxxxxoxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxoxxxxxxxxxxxxxxxxxxxxxoxxxxoxx",
-"xoxxxoxxxxxxxoxoxxoxxxxxoxxxxxxoxxoooxooxxxxxuqgggggggggggggjddhbirrwggggnddoouuti`fffbcvtuooxxxxoxooxoxxrsggggggggggggggjddddddhmivuoxxxxooxxxoxooookngdtv`fhhmcppooxooxxxxxxoxxxoxxxxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxoooxxxxxxxxxxxxxxxxxxxxxoxxxxxxoxooxxxxxxxxxxoxxxoxxxxxxxxxxxxxxoooxooxxxxxxoxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxooxooxxxxxxxxxxxxxxxxxxxxxoxxxxxxxox",
-"xxxoxoxxxxxxxxxoooxooxxxxxoxxxxxxxxxxoxxxxxoxokgggggggggggggnddhmtrwgggggdjuxoutibmffm`vpuooxxoxxxxooxxxxrwggggggggggggggddddddhhbipuoxxxrswarxooooxoxmhdutcmffbipxuxoxxxxxoxxxxxxxoxxxxxxoooxxxxxxxxxxxxxxxxxxxxxxxxxxxxxooxxxxxxxooxoxxxxxxxxxxxxxxxxxxxxxxoxxoooouoxxxxxxxxxooooxoxxxxxxxxxoxxxxxxoxxxxxoxxxxxxxxxxxoooooxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxooxxxxxxxooxooooxxxxxxxxxxxxxxxxxxoxoxoxxx",
-"xoxxxxxooxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxoeggggggggggggggdddsrwgggggdduoopti`mffb`ituxxxxxxoxxxxxxxxxrggggggggggggggnddddddhm`vpuoooorqggipxooxooxxxxupi`ff`vuoooxxxxxxxxoxuuuruoxxxoxxoxxoorreseeoxxxxxxxxxxxxxxxourrssseooxxxoxxxxxxxxxxxxxxxxxxxxxxxoxxourrasssroxxxxxxxoouooouooxxxxxxxxxxxooxxxxxxxxoxooxourrrsssserxxxxxxxxxxxxxxxxxxxxxxxxoorrassserooxxxxxorserxxxxxxxxxxxxxxxxoxxxxxoxx",
-"xxoxoxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxooxxxxxxxrggggggggggggggjdirwgggggdjuouuti`mffm`vtuoxxxxxxxxxxoxxxxoeggggggggggggggnddddddhmctuuoxorsgggdtxxxxxxxxxxopibmm`vuxxxouoooururrrsswqsuxxxxxxxrrswggggggkoxoxxxxxxxxxxrakqggggggkrxxxxxxxxxxxxxxxxxxxxxxxxxxxorrswgggqggqexxxxrrressssslksxxxxxxxxxxxxooxxxxoxoxorraswqggggggglsuxxxxxxxxxxxxxxxxxxxxraslgggqggglkrooxorsgggtxxxxxxxxxxxxxxxxoxoxxxox",
-"oxxoxoxoxxxoxxxxxxxxxxxxxxxxxxxxxxxxxooxxxxxxxowgggggggggggggnfrwggggnddooopti`mmfm`ippoxxxxxxxxxxxxxxoxrkggggggggggggggdddddddhmituoxxurqggndxxxxxxxxxxxopv`bbiprrrrrrsssswwlggggggjcxxxxxureqgggggggggqpoxxxxxxxorakgggggggggggexxxxxxxxxxxxxxxxxxxxxxxxorrsqggggggggggwxxrsggggggggggqcxxxxxxxxxxxooxxxxxxorrewgggggggggggggqsxxxxxxxxxooxxxxxorakgggggggggggggwsareqggndxxxxxxxxxxxxxxxxxxxxoxxx",
-"xxxxxxxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxooxxsggggggggggggggrsgggggdjuxouti`mffm`ituooxoxxxxxxxxxxxxxxrlggggggggggggggddddddhfbvpuoourkgggnfxxxxxxxxxxxxutc``vewlgggggggggggggggggdtxxxxorwggggggggggggguxoxxxxorsqgggggggggggggixxxxxxxxxxxxxxxxxxxxxxorsqgggggggggggggmxrlggggggggggd`xxxxxxxxxxxxxoxxxxurelgggggggggggggggggloxxxxxxxxxxxxxxrsqggggggggggggggggggggggnmxxxxxxxxxxxxxxxxxxxxxxox",
-"xoxoxoxxxxxooxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxrggggggggggggggsgggggdduouuti`mmfm`ituoxxov`pxxxxxxuxxxxxrggggggggggggggnddddddhfctuuooreggggjcxxxxibuxxoxooticipsggggggggggggggggggjhoxxxraqggggggggggggggnootoxureggggggggggggggggvbuxxxxxxxxxxxxxxxxxxrawggggggggggggggggvrgggggggggggduxxxu`vxxxxxxxxxxorakgggggggnjddmqgggggggqoxxxxxxxooooorsggggggggnjdddjggggggggggjmxxxxxxxxxxxxxxxxoxxoxxxx",
-"xxxxxoxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxooxxowggggggggggggggggggjdpooupi`bffm`cvpoxxxxvxxxxxxxovxxxxosggggggggggggggjddddddhmcpuooraqggggdpxxuuupixxxxoouvvtpeggggggggggggggggggjboxxraqgggggggggggggggn`ucpurwgggggggggggggggggjfoxxxibfcxxxxxxxxxxrrqgggggggggndddggggweggggggggggndoxxxoxtxxxxxxxxxorsqqggggggjdhvuusgggggggggoxoxxoooxoxreggggggggjdmvoxuclggggggggjixooooooxxxxxxxxxxxxxxoxx",
-"xxoxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxoxookgggggggggggggggggjdbpuutv`bmfm`itpuxxxxxtxxxxxxxcxxxxxrwggggggggggggggdddddddhfipupraqggggndvooptttcoxxxxouupuppljjgggggggggggggggdtuiraqggggggggggggggggghtpirsggggggggggggggggggn`uuoooxtxxxxxxutpxrsggggggggggddbppvkggwwggggggggggjhtuuuuovxxxxxxtpursggggggggjdbtourkgggggggggfpuouvuvtoorqgggggggndcoouptvpwgggggggdiopttvpoouoooooxxxoooxxox",
-"xxxoxxxoxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxrggggggggggggggggjdfivptvcbffm`ivpuooxxxxpxxxxxxxixxxxirqggggggggggggggdddddddhmvprreqgggggjfvmtviii`uoxxxxxouuopibb`sggggggggggggndppaaqggggggggggggggggggdivrsgggggggggggggggggggnfttpuoovxxxxxottvrsggggggggggddmiptvilgqgggggggggggdm`bptptiooxxobvarwggggggggjdmicbraqgggggggggjmcpu``vvirsggggggggdfvpptvcbccqggggggdtutciiitoutupuooxouoouxxo",
-"xoxxxoxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxulggggggggggggggjddbcivi`bfmm`itpuooxxxxxpxxxxxxxtxxxpuaggggggggggggggnddddfmbitrrslgggggggjcuu`i``i`uoxxxxxxxxoxxcoxrggggggggggggjhvaaqgggndjwggggggggggggd`reggggnddqggggggggggggnh`ivtuovxxxxxo`creggggggggggdd`chii`ikggggggggggggndcc`iiiv`uoxovourwggggggggjdfiicfrkggggggggggnfhvpiooxvrqggggggggdtivii``fbbsggggggdivv`civvuxtxuxxoxuoooooxx",
-"xxoxxxoxooxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxokgggggggggggggnddhfbcc`mmfm`cvpuoooxxxxxtxxxxxxovoxxvusggggggggggggggsrarrrssskwggggggggggdvut``bbc`uooxxxxxxxxxxvxxrggggggggggggdmerlgggjdbtaggggggggggggdsaqgggddbutkgggggggggggndfmcituixxvxxiursggggggggggjdc``b`mmmsggggggggggggjdbmmmb`c`puooturwgggggggggdmbccbcrgggggggggggndmcicpootegggggggggdtccbbfmhmmclggggnd`c`mb`iiuopxuxxoxuoooooxx",
-"oxxxoxxxxxoxxxoxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxeggggggggggggggdddhmmbmmfm`itpuooxxxxxxxtxxxxxxxcxooorlggggggggggggggggggggggggggggggggggndupmbbmbicuoxxxxxxxxxxxvoorgggggggggggndbrwgggdd`purgggggggggggnbrlgggddpoxasgggggggggggjdhhm`vpioxvxxirsggggggggggjdhic`mfhj`sggggggggggggdhhhdhhmc`pooxrrwgggggggggdjpfciccsgggggggggggndhb``puoasgggggggggdimbfhhhhmm`sggggndmmmffbcvuotxoxxoxuoxoxxxx",
-"xxxxxoxxxxxxoxxoxxxxxxxxxxxxxxxxxxxxxxxoxxoxxxxxxuqgggggggggggggjddhhffhfmbitpoxxoxxxxxxxpxxxxxxxcuoxxrgggggggggggggggggggggggggggggggggggjfff`bmmhhfmixxxxxxxxxvbmmesgggggggggggjdrsgggddffptagggggggggggnrsgggddvuoorkgggggggggggjdddhmffmmmmxxraqggggggggggdmcfjhhhddisggggggggggggdddddhhdhfmmoorwgggggggggndvtifjhbsgggggggggggndhhfhmptewgggggggggjhhdjhhjhff`eggggjdhhjdhmbcutpxuoxpxxouoooxo",
-"xoxoxxxoxoxxxxoxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxokgggggggggggggnddddhhfmbcvpooooooxxxxxxvtxxxxxxxioxregggggggggggggggggggggggggggggggggggdivcbfff`vpuxxxxxxxxxxxxxxrkgggggggggggdeaggnddmitursgggggggggggseggndd`vptirlgggggggggggddddhfbipoxxourqggggggggggjdibmhhddhhslgggggggggggjddddddhm`tuxorsggggggggggdfvc`mhhfsgggggggggggdddhfmcturwgggggggggghhhddhm`ivtalgggjhhhdhhmituoxoxxxxxxxxxxxxx",
-"xxxxoxxxxoxxxoxoxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxeggggggggggggggddddhhfbitpuoxxxxoxxxxxxuvuxxxxxoooxrkggggggggggggggjdjjjjnnggggggggggggndiibmhfm`tpoxxxxxxxxxxxxxxuwggggggggggnmrlggddhbiturkgggggggggggrqggjdh`iptvaggggggggggggdddddhmctoxxorwggggggggggndb`fhdddhhfawgggggggggggjddddddhmctuoraggggggggggndicbffhjh`ggggggggggnddddhf`iprwggggggggggndddhfbitpuukgggdhhddhhbipuoxxooxxxxxxxoxox",
-"oxoxxoxoxxoxxxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxuqgggggggggggggjddddfmcvpooxxxxxoxxxxxxxxxxxxxxxxxxrlggggggggggggggddddddddjjjgggggggggnjibfhhhmctuxxxxxxxxxxxxxxxrgggggggggggnrsggjdjf`vptrlggggggggggkkggjddfbitpasgggggggggggndddddhm`tpoxrsgggggggggggdhbfhhdddhfbrqgggggggggggdddddddfbvpuorqggggggggggdmcbfhddhfmwgggggggggddddddfmiprwgggggggggggdddhmcvpuoosgggd`fhddfbipoooxxxxxxoxxxxxxx",
-"xxxoxxxxoxxxxxxoxoxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxuwgggggggggggggndddhf`vpuoxoxxxxxxxxxxoxoxxxxxxxooorggggggggggggggndddddddfbcv`qgggggggjhmfhjdhbipoxxxxxxxxxxxxxxosgggggggggggaeggnddhmcvppagggggggggggsggndddfbivtrlgggggggggggjdddddhfcvpooaqggggggggggndmfhddddhfbvrgggggggggggnddddddhf`vuorkggggggggggndbmfhddhhmcvqgggggggjddddddhmctpwggggggggggggddhmituooooggndcmhhhfbvpuxxoxxoxxxxxoxxox",
-"oxxxxxoxxxoxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxraqggggggggggggggdddhmituoxxxxxxxxxxxxxxoxoxxxxxxxorsggggggggggggggjddddddhhm`cvvwggggggdhhdddhfbipoxxxxxxxxxxxxxxrkgggggggggggrqggdddfbivtrsgggggggggglqggdddhf`iveaggggggggggggddddddhmcvuorkgggggggggggjdfhdddddhmcasgggggggggggjddddddhmituragggggggggggjjmhhdddhf`ipobnnnnjddddddddhmctusggggggggggggfdhmipuoooxoddhibfhhf`vpooxoxxxxxxxxxxxxx",
-"xxoxxxoxoxxxxxxooxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxorwgggggggggggggggjddhbcpoxxxxxxxxxxxxoxxxoxxoxxxxxxuwggggggggggggggddddddddhfbb``sgggggndhddddhf`vuxxxxxxxxxxxxxxxrlggggggggggswggjddhm`vtvrwggggggggggqggnddddfb`ctsggggggggggggddddddhfcturegggggggggggndhhddddhhmcvpsgggggggggggdddddddhbiporlgggggggggggdfhhdddhhbipoxxobffjddddddddhmcpueggggggggggggghhmctoxxxxxouut`mhhm`tuooxxxoxxoxxxxxxxx",
-"xxxoxxxxxoxoxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxrrwggggggggggggggggjddhmctoxxxxxxxxxxxxoxxxxoxoxxxxxxrqgggggggggggggnddddddddhfmmbbcwggggjddddddhmctuxxxxxxxxxxxxxxxrgggggggggggsggndddhm`ciirgggggggggggggnddddhfm`crlgggggggggggjddddddhmiturlgggggggggggjdhdddddhfbiprlggggggggggnddddddhf`vpregggggggggggjdhhddddhmcvpuoxootibfdddddddhmiporgggggggggggggghf`vuoxxoxooutibffmcvuooxxoxxxxxoxoxoxx",
-"xoxxxxoxxxxxxoxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxorwggggggggggggggggggddhf`vuxxxxxxxxoxxxxxxxxxxxxxxxxxaggggggggggggggndddddddhfmbbbbckggggdddddddfbituxxxxxxxxxxxxxxosggggggggggllggddddhmciceegggggggggggggjdddddfmbiaggggggggggggjddddddhbipregggggggggggndjddddddhbitprgggggggggggjddddddhfcturlgggggggggggjdhdddddfbituxoxootibfhdddddhfbipookgggggggggggggghbipuxxoxxxopv`mmbituxooxxxoxoxxxxxxxx",
-"xxxxxxxxoxoxxxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxorwgggggggggggggggggggdddf`vuoxxxxopxoxxxxxxxxoxxxxxxxusggggggggggggggjddddddhdhbcii`vsggggddddddhdfipoxxxxxxxxxxxxxxrwggggggggggqggjdddhfb`ccakggggggggggggndddddhffmakgggggggggggnddddddhf`iprlgggggggggggjdddddddhm`vpuegggggggggggdddddddhbcpregggggggggggndhdddddhm`tpooxoxupv`mhddddhhbcvuoxrggggggggggggggqmcvpoxxoxooutc`b`vpuoxxoxxxxxxxxxxoxx",
-"xxoxxoxxxxxoxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxrsgggggmlgggggggggggggnddhmcpoxxxx`uxxoxxxxxxxxxxxxxxvrwggggggggggggggddddddddb`itttiasgggnddddddhmmtpoxxxxxxxxxxxxxxrqgggggggggggggddddhfb``irqggggggggggggjdddddhhj`rqgggggggggggndddddddf`vreggggggggggggddddddddhbiturkgggggggggggdddddddfbvprkgggggggggggndddddddfbcpuoxxxxxutibffhhhhm`vpuoxokggggggggggggggmbipuoxoxooupv`cctpoooxoxxoxoxoxoxxxx",
-"oxxxxxxoxoxxxxxoxxxoxxxxxxxxxxxxxxxxxxxxxxxorsgggggjhkgggggggggggggnddhm`tuxxxx`xooxuvtxxxpuxotuxucrggggggggggggggnddddddhdmctpuiiusgggjhfhdddhmbpuoxxxxxxxxtutxtuegggggggggggggndddddhbb`eeggggggggggggnddddddhhhieggggggggggggdddddddhmctrlgggggggggggndddddddhm`vuorqggggggggggjddddddhfcvurggggggggggggjddddddhf`vpoxxxxxoouvi`mmmmb`vtuoxxxrqggggggggggggggf`vpooxoxooptvivpuoxxxxxxxxxxxxxxoxx",
-"xxxoxxxxxoxxxxxxoxxxoxxxxxxxxxxxxxxxxxxxxxorsgggggjdtaggggggggggggggdddfbipoxxupxooxivtixxpiouvvoueeggggggggggggggndddddddhmcpuov`osgggdmffhdhfbbpoooxxxxxxo`ii`tesgggggggggggggdddddhdfb`akggggggggggggjddddddhhmakggggggggggggdddddddfbiraggggggggggggddddddddhbituuegggggggggggjddddddhmctrsggggggggggggdddddddhm`tuoxxxxxxouutvccccivpuoxxxxxsgggggggggggggggfcvpooxxxooupppuooxxoxxxoxooxoxxxox",
-"xoxxxxxxxxoxoxxxxxxxxxoxxxxxxxxxxxxxxxxxxxrsgggggjdvxrlgggggggggggggjddhbctoxxtxxxoocm`ixxxvxxxvxxakggggggggggggggjddddddhfcpuooovusgggdvbbhhhf``pxxxcmbbbixvvxvxrlggggggggggggjddddddhdbcrqgggggggggggnddddddddf`rqgggggggggggjdddddddf`irkggggggggggggdddddddhf`vporkgggggggggggdddddddfbvprwgggggggggggndddddddf`vtuoxxxxxxxooopttvvtpuoxxxxxxxwgggggggggggggggmctuooxoxoouuuuoxxxxoxxxxxxxxoxxxx",
-"xxoxoxoxxxxxxxxoxxxxxxoxxxxxxxxxxxxxxxxxoraqggggjdvxookggggggggggggggddhfcvuxxvxxxxvpoxixxoioxxtxxrlggggggggggggggddddddhffvpoooxvokggjdpb`fhhmc`uxxxxoooxxxttxtorgggggggggggggjdddddhhhbveggggggggggggjdddddddhmseggggggggggggjddddddhm`trqgggggggggggjdddddddhmctuorqggggggggggnddddddhf`vurggggggggggggnddddddhm`touxxxxxxxxxoooouuuuoooxxxxxxxxqggggggggggggggj`ctuooxoxxoooxxxxxxxoxoxoxoxxoxxx",
-"oxxxxxxxxxxxxxxxxxxxxxoxoxxxxxxxxxxxxxxxraqggggndcxoopsggggggggggggggdddfbipuxutxxxixxu`xxoixovvxorggggggggggggggnddddddhfmvpoxxxvxeqgjboccmffbicuruxxooxooovtxvosggggggggggggndddddddhm`rkggggggggggggddddddddhbakgggggggggggndddddddhmiaeggggggggggggdddddddhf`vpouegggggggggggjddddddhm`treggggggggggggjddddddhbitoxxxxxxxxxxxxxxoooooooxxxxxxxxrqggggggggggggggh`ituooxxxxxxxxxxxxxxoxxxxxxxxoxx",
-"xxoxxoxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxraqggggndmououvvqgggggggggggggjddfmctuxx`xxxobmviixoumbpmprsggggggggggggggjdddddddhhf`oxtmbmb`mdhffhhmmhfmaslkxxxxxopmixbrkggggggggggggjdddddddhmcrlgggggggggggjjddddddhfcrqgggggggggggnddddddhf`vrkggggggggggggdddddddhmctporkgggggggggggdddddddhbctusggggggggggggdddddddfbvuuoxxxxxxxxxxxxxxoxoxxxoxxxxxxxxsggggggggggggggnm`vpuoxoxxxxoxxxxxxxxxoxoxoxxxox",
-"oxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxuaqggggndmooupvcbsgggggggggggggnddhmcvpoxpuxxxxxxxxxxxxoxxxrwggggggggggggggdddddddhbipuxxxxxxxxxxxutibfbctraqggbxxxxxxooxxrqggggggggggggdddddddhfbtaggggggggggggddddddddhbeeggggggggggggdddddddhm`vrlgggggggggggnddddddhh`ipooagggggggggggnddddddhf`vprwggggggggggggddddddhm`vooxxxxxxxxxxxxxxxxxxxxxoxxxxxxxookgggggggggggggghmcvpoxxxoxxxoxxxxxxoxxxxxxxxxxx",
-"xxoxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxurwgggggdmxoupvc`msggggggggggggggdddf`vpuooxxxxxxxxxxxxxxxxorqggggggggggggggddddddhf`vuoxxxxxxxxxxxoti`m`iprwggnduxxxxxxxxuaggggggggggggjdddddddhm`asgggggggggggndddddddhf`akggggggggggggdddddddhbiprggggggggggggjddddddhfcvuorsgggggggggggjddddddhfcvurwggggggggggggddddddhmctuxxoxxxxxxxxxxxxxxxxxxxxxoxoxxxxxolgggggggggggggjfbctuooxxxxxxxxxxxxxxxoxxxxoxxx",
-"oxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxurwggggndhxooptcbmfcqgggggggggggggjdhhbituooxxxxxxxxxxxxxxxxoeggggggggggggggnddddddhmctuoxxxxxxxxxxxuti`b`vrsgggjfxxxxxxoxxusggggggggggggddddddddfbirlgggggggggggjddddddjhbirlgggggggggggjdddddddfbvreggggggggggggdddddddhbipuurqgggggggggggdddddddhbitorggggggggggggnddddddhbipoxoxxxxxxxoxxxxxxxxxxxxxxxoxxxxxooulgggggggggggggdf`vtuxxxxxxxxxoxxxxxxxxoxxxoxx",
-"xxoxxoxxxxxxxxxxxxxxxxxxxxxxxxoxxxxurwgggggdjuxoutc`mfmbsgggggggggggggnddhmituooxxxxxxxxxxxxxxxxrsggggggggggggggjddddddhmitooxxxxxxxxxxoopic`craqgggjixxxooxxoorwggggggggggggdddddddhm`tagggggggggggnddddddjhm`vaggggggggggggdddddddhm`tusgggggggggggndddddddf`iuursggggggggggggdddddddfbiporggggggggggggndddddhf`vpoxxoxxxxxxxxxxxxxxxxxuerxxxoxxxxxouaqggggggggggggdhm`vuooxxxxxxxxxxxxxoxxxxoxxox",
-"oxxxoxxoxxxxxxxxxxxxxxxxxxxxoxxxxxorwgggggdhuouupibmfmbcaggggggggggggggddhf`tpooooxxxxxxxxxoxxxxrwggggggggggggggdddddddf`ipxxxxxxxxxxxxoopticarlggggdpxxxououoorggggggggggggjdddddddhbiasgggggggggggnddddddjfbirsggggggggggggdddddmdhmctrkgggggggggggnddddddhmcvuurqgggggggggggnddddddhfcvporggggggggggggndddddhmcvuoxxxxxxxoxxxxxxxxxxxxaggkxxxooxxxxousggggggggggggjdhbctuoxxxxxxxxxoxxxxxxxxxxxxx",
-"xxoxxxxoxxxxxxxxxxxxxxxxxxxxoxxxxorkgggggjduooutv`bfmmcvaqgggggggggggggjddfbipoxxxxxxxxxxxxxxooorggggggggggggggnddddddhf`tuoxxxxxxxxxxxoooptprwggggjjxooouppuorsggggggggggggdddddddhf`trwgggggggggggddddddjhf`vrwgggggggggggjddddhrs``ipuwgggggggggggjddddddhbctorsggggggggggggjdddddmmmituorggggggggggggndddddhmipuoxxxxxxrsqaxxxxxxxxxxegggmxxxoxoxxxouwgggggggggggndhf`ipuxxxxxxxxxxxxxxxxxxoxxxx",
-"xxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxoorsgggggjdvouppi`bfmmcvprkgggggggggggggjddhm`tuoxxxxxxxxoxxoxoxrsggggggggggggggnddddddhmctuxxxxxxxxoxxxooourrwgggggd`xoupttpporkgggggggggggndddddddhmctrggggggggggggddddddjhmctrqgggggggggggdddddaegg`turwgggggggggggjdddddhf`vpraqggggggggggggdddddjrssiuxxrggggggggggggndddddhbipuxxxxxxraqqgkxxxxxxxxosgggdxxxxxxoxoourqggggggggggnddhmctuoxxxxxxxxxxxxxoxxxxoxox",
-"xoxxxoxxxxxxxxxxxxxxxxxxxxxxxxxorsgggggjdvoouti`mfmmcipoosggggggggggggggddhf`vpooxxxxxxxoooxxoxukggggggggggggggjddddddhbiuoxxxxxxxxxxoxooxurwggggggdpouptiivpurlgggggggggggjddddddhh`irsgggggggggggjddddddjf`iaaggggggggggggdddd`rgggjcuuwgggggggggggjdddddhf`vprkgglggggggggggdddddeaggluxxuqggggggggggggdddddhbvuuxxxxxurlgggjbxxxxxxxokgggjoxxoxxxxoxuusggggggggggnddhfbipooxxxxxxxxxxxxxxxoxxxxx",
-"xxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxrsgggggjdvoouticmmfmcvtuxorggggggggggggggdddhbipuxxxxxxoooxoxxoxrlggggggggggggggdddddddf`vuooxxxxxxxxxxxxxrrwggggggndxopti``ituaggggggggggggdddddddhm`trwgggggggggggdddddddhf`vrsgggggggggggndddhrkggndiorwgggggggggggjdddddhmctrsggkggggggggggnddddcrqggjbxxowggggggggggggdddddf`iuxxxxxorwgggndvxxxxxxxrwgggnvoxoooxxoooorqgggggggggndddhmctuxxxxxxxxxxxxxooxxxxoxx",
-"xoxoxxxoxoxxxxxxxxxxxxxxxxxxxorsgggggndbxuupi`bfmm`ipuoxxulgggggggggggggnddhmctpuxoxxxoxooxxxxuaggggggggggggggnddddddhf`vuoxxxoxxxvbpoxoraqgggggggjmoptc`b`itreggggggggggggdddddddhbiprggggggggggggdddddddhbitrkgggggggggggjdddeegggdmuoowgggggggggggjdddddhbiraqggsggggggggggjdddmrwggndcxxokggggggggggggndddhh`vpxxxxxrsggggdhxxxxxxxxrlggggmuuuuuoooxoousgggggggggjdddhf`vpoxxxxxxxxxxxxxxoxxxxox",
-"xxxxxoxxuxxxxxxxxxxxxxxxxxxuorsggggggdfooutvcbffm`ituxxxxowggggggggggggggddhf`vpooxxoxxxoxooxxukggggggggggggggjddddddhmctuooxxxxxxxxvorrkgggggggggdvptv`fm`vprlgggggggggggjddddddhf`vregggggggggggnddddddjfbiprwgggggggggggdddaaqggjdvuookggggggggggggdddddf`raqggwkggggggggggjddfrsgggdfoxxxegggggggggggggdddhf`vuxxxorsggggjjoxxxxxooorgggggjupttppoooxooegggggggggdddddfbipoxxxxxxxxxxxxxxxoxoxxx",
-"xoxoxxxxuxxxxxoooxxxxuoxxxxareggggggnduvppicbffm`iiipxxxprsggggggggggggggnddfbituoxxotpvovuoxorlggggggggggggggjddddddhbitoxutvxxxoooarelgggggggggndivi`fhhm`urggggggggggggjddddddhfctrkgggggggggggjddddddhf`vprlgggggggggggddaaqggndbuooxsggggggggggggqdddh`aaqggnrwggggggggggjdfrsgggjdtoxxxoqggggggggggggqdddf`tuoxurwggggjdvxxouuuuuorggggggvtivvpuoooxorgggggggggdddddhbctuoxxxxxxoxoxxoxxxxxoxx",
-"xxxxxoxooxxxxuuutxxotuptpxurwgggggggnfbctvcbffmbivivipxxttsggggggggggggggghdhmctuoxxociicvcxxregggggggggggggggjdddddhf`vpuxvvvixxourelgggggggggggjhcf`mhhfbireggggggggggggdddddddhbiprqgggggggggggdddddddhbiturggggggggggggwraqggndhtuoxurgggggggggggggwkcrrsqggndrggggggggggglsrsgggjd`uooooukggggggggggggglbmf`turralggggndcxoouptvtpuegggggghic`ituooooorggggggggjdddddhmctuxxxxxxxxxxoxxxoxoxxxx",
-"xoxxxxxoxxxxxpooxxxpuupuvrawgggggggggmpivcbffmbivp`bitxoorsgggggggggggggggqhhfffmbbixptxvovorrlgggggggggggggggjdddddddhmtuxi`cvurrslgggggggggggggdfc`mfhhmcprkgggggggggggnddddddhf`vregggggggggggnddddddhhbvpurgggggggggggggwggggjd`tuouptwggggggggggggggwwgggggdhrggggggggggggwlgggndfpuxoupptqgggggggggggggqserraelgggggndmoooutvccvtrsggggggq`bb`vuooooregggggggnddddddhfctuoxxxxxxxxxxxxxxxxoxox",
-"xxoxoxooxxxxxxxopxxtuuprreqggggggggggktccbfffbcvpioxotoorrlggggggggggggggggqk``ipoxxxtpxvoprrwggggggggggggggggqbfdddhbituoprrraswgggggggggggggggndibhhhhh`vprlgggggggggggjddddddhmctrsgggggggggggjddddddhm`vuurgggggggggggggggggjdmvpuoptisggggggggggggggggggggdhurggggggggggggggggndhipuoupvvvsgggggggggggggggggggggggggndmooxupic``ctrsgggggggqbmbcpoxoorlgggggggjddddddhm`tpoxxxxxxxxxoxoxxoxxxxx",
-"xxxxxxxooxxxuoxxouxotrrewggggggggggggglsrvffmcvpuixrrrraslggggggggggggggggggglsaruxxxppurrasqggggggggggggggggggqksrrrrrresskwqggggggggggggggggggnj`mhddhh`vpaggggggggggggdddddddhbitrlgggggggggggdddddddhbipooulgggggggggggggggjdh`vpuuvicclggggggggggggggggggjdtxulgggggggggggggggdd`vppppiicivkgggggggggggggggggggggggndmxxoptvcbb`ctrwggggggggwbm`tuxursgggggggjdddddddhfctuoxxxxoxxxxxxxoxxxxoxx",
-"xoxxoxoxuoxxouppuxxxoeqggggggggggggggggggqnm`ipoxt`rwqggggggggggggggggggggggggggglexu`vrwgggggggggggggggggggggggggggggggggggggggggggggggggggggggdhhddhdhfmmesgggggggggggnddddddhf`vragggggggggggndddddddfbvuoxokggggggggggggggjddm`vpptic`isqggggggggggggggggjdixxosggggggggggggggddfcvpppvi`citpkgggggggggggggggggggggjdmxxxppvc`mb`vtrwgggggggggletarrakgggggggjdhhdddddhmctoooxxxxxxxxxoxxoxoxxxx",
-"xxoxxxxxooxoxxxxxxxxosggggggggggggggggggggghctuoxxxrggggggggggggggggggggggggggggggncxxxrggggggggggggggggggggggggggggggggggggggggggggggggggggggggdhhhddhhbiprwgggggggggggjddddddhmctrkgggggggggggjddddddhfcvpoxxuqggggggggggggjddhmcvttic``ipsgggggggggggggggdd`puoupqgggggggggggnddjf`vttvc``cvpuo`ggggggggggggggggggnddioouupvc`mb`iturqggggggggggggwwlggggggggjdfmhdddddfbitooxxxxxxxoxxxxxxxxoxox",
-"oxxxxxoxxoxxxxxxxxxxxagggggggggggggggggggggdipoxxxxxggggggggggggggggggggggggggggggnmxxxxgggggggggggggggggggggggggggggggggggggggggggggggggggggggndhddddhf`vpoggggggggggggdddddddhmitukgggggggggggdddddddhmctuoxoxrggggggggggjddddhf`ivic``cvpucggggggggggggjddbivtptvcggggggggggjdddhf`ivic```ituooucnggggggggggggggnjdhtooupticbmm`cvporggggjjjnggggggggggggggjdj`imhddddhf`vpooxxoxxxxxxoxxxxoxxxxx",
-"xxoxoxxxxxxxxxxxxxxxxxtdddddddddddddddddddddipoxxxxxxddddddddddddddddddddddddddddddfooxxxdddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddhmctpooddddddddddddddddddf`vpoxmdddddddddddddddddfbipooxxoxunngggnnjddddddhhbb`bb`cvpuoopnnggggggnjdddhf`ciicc`bnggggggnddddddhm````b`itpoooouthjnggggggggnnjddctttttvccbmbbcvpuuugggdjccmjjnggggggggnjdd`ppimhddddhbctuooxxxxoxxxxxxxxxxxoxxx",
-"oxxxxoxoxoxxxxxxxxxxxxxxxoooooppvc`mhdddddhmctuoxxxxxxxxxxooouppibfdddddddddddddfbcvpuoooxoxxooxoupvcbfjddddddddddddf`ipuuoooooouuppptvvi``mfhhdddddddhbitooxxoooouv`fjdddddddhfcvuoxxxxxoupcmhdddddddhm`vuooxxxoxo`fddddddddddddhfmmbb`ituuxuoubjjjjjddddddjhfmbbbbmbbfjjjdddddddddhfmbbb`cvpuooxoupi`hddjjjjdddddfbcciicc`bmmmbcvtuoooejdhpupcmhdddjjjjdddmcoouvcfhdddhm`ipuoxxxxxxxxxxxxxxxxxxxox",
-"xxoxxxxoxxoxxxxxxxxxxxoxxxoouptvc`mhhdddddhmbivppooxxxxxxooupptvcbhhddddddddddddhfbcivppuuooooooppvi`fhdddddddddddddfmcvtppupppppttvvic`bmfhhddddddddhf`vpuoxxxxoouv`fhdddddddhmctuxxxxxxoptcmhdddddddhmctuoxxxxxoooui`fddddddddddhffb`ivpooxxuutcbhddddddddddhhfffmm`cvvmfhdddddddddhhfmbcvpuoxxxxoutibfhdddddddddhhmmmbmmfffmbcvtuoxxouvvtxuvcmhdddhhmb`uuuooutibfhdhhfbituooxoxoxxxxxxxxxxxxxxxxx",
-"xxxxxoxxxxxxxxxxxxxxoxxxxxoupti`bfhhdddddddfm`citpuxxxxxxuuptvccbfhddddddddddddddhfm`civtuuoxooptv`bmhhdddddddddddddhfm`civvvvviiic``bmmfhhhdddddddddhm`tuooooxxoopibfdddddddhfbvpoxxxxxoopv`fhddddddhhbitoxxxooxxxouv`mhdddddddddhhmbctuooxoxoouv`mhddddddddddjhhfm`ivtpv`mhdddddddddhfb`ituuxxxxxooptcbfhddddddddddhhhfhhffmbcvupuxooxoxxxouv`fhdjdhfb`ittppppicmhhdhfbcvuuxxxxxxxxxxxxxxxxxoxxoxx",
-"xoxxxxxxoxoxoxxxxxxxxxxxxxxuticbmhhdhddhdhhhfmb`itpoxxxxoupvicbbmhhdddddddddddhdhhhfmb`citpoouuvc`bffhhddddddddddhdhhhfmb```````bbbbmffhhhdhhddddddhhfbipuxxxxxooupibfhdddddhhm`vuoxxxxxootv`fhdddddhhm`vpooxxxoxxxoupcbhhddddddhhhmbivpuxoxxxoouti`mhdddddddddhhfm`ituuptcbhhddddddhhfb`vppooxoxxxxoupvcbmhhdddddddddhdhhhfmbivpuxuxxooxoxoopt`mhhhhhhfb`civvvc`mfhhhmbctpuoxoxxxxxxxxxxxxxxxxxxxxx",
-"xxoxxxxxxxxxxxxxxxxxxxxxxoouti`mmffhfhfhhhffmmb`cvpoxxxxoupvc`bmmffffffhfhffhfhfhffmmbb`ivpuoupvc`bmffffffhffhfhhhhhffmmbb`b`bbbbbmmmmmffffhffffffhffbcvpoxxxoxxooti`mfffffhfmbitpxxxxxxxupv`bffffffff`cpuooxoxxoxxoopv`mhhhdhdhhfm`ituoxoxxxoxoopti`mfhddddhdhhfm`ituooopvcmhhddddhhfb`vtuoooxxxxxoooopti`mfhdhddddhdhhhfmbcivpuoxxxxxoxoxoopv`mfhfffmmmm```c`bbmffmm`itpooxoxoooxxxxxxxxxxxxoxxoxx",
-"xxxxoxxxxxxxxxoxxxxxxxxxxxoutvc```bbbbbbbbbb```civpoxxxxxupvi`c```bbbbbbbbbbbbbbbb`bb`ccitpooouvic```bbbb`bb`bbbbbbb`b````c`c```````b``mbbbbbbmmbbb``ivpuxxxxxxoxopvc`bbbbb```itpoxxxxxxxouti``bbbbb``ivpoxooxxxoxxouupicbfffffmb`cvtuooxxxxxxxooupti`bmffhhhffm`cvtpoxxoopicmffhfhfb`cvpuoxxxxoxxxxxoouutvc`bmffhfhhhffmb`ivtuuxxxxxxxxxxxouptcbbb````bbbbbbb`bmmmb`cvtuooxxxxxxoxxxxoxxxxxxxxxxxox",
-"xxoxxxoxxxxxxxxxxxxxxxxxxxoouttiiiviivivvvvvviivtpupxxxxoouptvvivivvvviiiviiviiiiviiiivvtpuuoot`tvviiivvvivmbivvvviiiciivivvcvvv`mcmivi`ivivvii`iiivvtpuooxxxxxoooupbcvvvvivvvtpoxxxxxxxoou`bvvvviicbttpupcucpoxoxxxooupvic````civtpuoxxxxxxxvtxxxoptvi`bbbbb``citpovcpxxoupvi`bmb``cvppooxxxxxxxxxxpcxxouptvc``mbmbbb``civtpuooxxxxxxxxxxxxxuticciivvviccc```````ccitpuooxxxxxxxxooxxxoxxxxoxxoxxxx",
-"xxxxoxxxxxxxoxxxxxxxxxxxxxxxouuppppppppppppuupppuuiuxxxxxxouuuupuupppupppppuppuptpppppppuoooooovuupppppppptftppuppuuctpppppvipppvbifpppuippupppippppuuoxxxxxxxxxooouuippppuuvuuuoxxxxxxxxooovuppuuvtp`vooomompxxoxoxoooupttvvvvttpuuooxxxxxxxxpxxxxxuitviiiiivvtpuuooxpxxxooptviiiivtpuooxxxxxxxxxxxxtxooxouutvvibiiiivvtppooxxxxxxxxxxxxxxxooutvvtppppptvviiiiivvttppuoxoxxxxxxxxxxxxxxooxxxxxxoxxx",
-"xoxxxxoxxxxxxxxxxxxxxxxxxxxxoooxuouoooouuooxoooooxixxxxotpoxotuptpooppottoooxutvoooppptuoooxututooooooooooviooooooouioouuouioooot`uboooovuooxoouvoooooxxxxxxuuoptooootpvooopitttxxpopxuuxxxotoooootooooxxxmx`oxxxxxxxoxoouupppuuuooooxxxxxxxxxpopoxouivvivtvvvtptooxxxpxxxoxouuppvvvtupxxxxupoxxooptopxxootpouuppcttppppuuooxxxxxxxxxxxxxxxxxxopuuuuoooouupppttpppuuoooxxxxxxxxxxxxxxxxxxxoxxxoxxxox",
-"xxoxxxxxoxxxxxxxxxxxxxxxxxxxxoooxxooxoxxoxxxxoxxouuxxxxppttxxtiipvtouictpcoxtiptcoopctttuxxttpicoooooxoxoovuxoxxoxxupoooooovxooooixioxxoxvxxxxxxvxxxxxxxxxxxuiitpcxxx`ptixxuiptuxxpcpittpxxxpxxxxxucpuxxxxcxvxxoxxxxxxxxxoooooooooxxxxxxxxxxxxvtttuxoittvuutcvctttxxxxpxxxxxxxouotctctptxxtvpipoxptpiioxtvppcuoooppouoooooxxxxxxxxxxxxxxxxxxxxouoooxoxooxoooououuooooxoxxxxxxxxxxxxxxxooxxxoxxxxoxxx",
-"xxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxpxxxxxtcvtxxxtxxxtxxtoxoopovpppvixxpxxopoxtxxxtxxxxxxoxxxxxxxxxoxopxxxooxopoxxxxxxxxoxxxtoxxxxxotxxxxxxxxxxxtxxxopxxpxxpxxxpxxxxxxixpxxpxxxpxxxxxxxxtpxxxxoxxxxoxxxxxxoxxoxxxxxxoxoxxxxxxxxxxpxxxpxxpxooooocxtxxpxxxxpxxxxciccipxixpxxuxuoxxxpxxtxxxtxxvppptvxxxxtxxxoxoxxxxxxxxxxxxxxxxxxoxxxooxoxxxxxoooxoxoxooooxxxxxxxxxxxxxxxoxxxoxoxxoxoxxoxx",
-"xoxoxxoxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxpxxxxpuxxtxxxtxxxtxxtxxxopxcpptpuxopxxxpxxpxxxpxoxxxxxxxxxxxxxxxxopxxxxxoxpxxxxxxxxxoxxxovxxxxxxixxxxxxxxxxxtxxxopxxpxxpxxxpxxxxxxixpxxpxxxpxxxxxoxxopxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxpxxxtxxpxoxoxxixpxxpoxoopxxxxxxxxxoxixpxxuxpxxxxpxxpxxxpxxipppppxxxxpxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxox",
-"xxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxuxxxtxxovxxxcoxotxxvtxovoxttxxxoxxpoxxpxxvxxucxxxxxxxxxxxxxxxxxxxopxxooxotxxxxxxoxxxxxoxtxxxxxxuoxxxxuvxxxxvtxovxxxpxxuxxxtxxxoxxvxpxxpxxxuxxxxxvvttxxxxoxxxxxxxxxxoxxxxxxxxxxoiuxxxxxxxxxxxpxxxpxxpoxoooxixpxxpoxxxpxxxxxxxxxxxixuxxuxxvoxutxxvoxucxxttxxxoxxxtxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxoxxxxxxxxxxxxxxoxxxxxxxxxxxxoxxxxxoxxoxxoxxxxxx",
-"xoxoxoxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxvxxxxiiptpxxptitxxxuuivooxxuiipoxtipxtixxxtituixxxooxxxxxxxxxxxxxxvxxxooxtoxxxxxooxxoxxxotxxxxxxvxxxxuvxxxxuuivoxxiixuivxxxvivuxiixpuxixpiivvuxxxxuxxxxxxxxxxxoxoxxoxxxxxxxxxxoiuxxxxxxxxxxpiuxiiuxxtiipotiuutxtuoiiiitxxxxxxxxtiuupxpoxxvvtxxxxvituixxovipxooxvxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxooxxoxxxxxxxxxxxxxxxoxxxxxxxxxxxxxoxxxxoxxoxxxoxoxx",
-"xxxxxxoxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxooxxxxxxxxxxpxxxxxxpxxxxxxoxxxxoxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxuuxoxxxxtxxxxxxxxxxoxxxuxxxxxxoxxxxxxxxxxpxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxuxxxxxoxoxxxxoxxxxxxxxxxxxxxoxxxxoxxxxxxxxxxxxxxxoxoxoxxxxxxxxxoxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxtoxxxxxxxxxxxxxxxxxxxxxxxxoxoxxxoxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxoxoxoxxxxxxxxox",
-"xxoxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxvivxxxxpivoxxxxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxoxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxpiioxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxoxxxxx",
-"oxxxxoxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxoxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxoxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxoxxxoxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxoxoxxoxxxxxxxx",
-"xxoxxxxxxooxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxoxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxoxxoxxxxoxx",
-"oxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxoxxxxoxxxxxxxxxxxxxxxooxxxxxxxxxxxxxxxxxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxoxxxxoxxxoxxxxx",
-"xxoxxxxoxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxoxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxoxxxxxxxoxxxxoxox",
-"xxxoxoxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxoxxxxxxxxxxxxxxxxoxxxxxoxxxxxxxxxoxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxoxoxxxxxxxxxxxxxoxxxxxooxxxxxxxxxxxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxoxxxxxxxxxxxxxxoxxxxoxxxxxxxxxx",
-"xoxxxxoxxooxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxoxxxxxxxxxxxxxxoxooxxxxxxxxxxxxxouxooxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxoxxooxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxoxxxxxxxxxxxxxxxoxoxxoxoxoxxxox",
-"xxxxoxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxoxxxxxxxxxxxxxxxxxxxoxuxxxvpppxxxpxxxxxxpoxxxxxxxxxxxxxxxxxxxopxxxxxxxxxxxxxxxxxxxxxxpuxxxxxxpxxxxxupopxxxxxxxxxxxxxxxxxxxxxxxxoxoxxxootuxxxxxxxxxxxoooxoxxoxxtpxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxuuxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxoxoxxxxxoxxxxxxxxxxxxxoxxxoxxxxxxxxxxx",
-"xxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxooxoxoxxxxxxxxxxxxxxtoxxxtpttxxxooxxxxxxpxxxxxxxxxxxxxxxxxxxxuxxxxxxxoxxxxxxxxxxxxxxxuxxxxxuxxvxxxuvuixxxxxxxxxxxxxxxxxxxxxxoxoxxoxxxoxuxxxxxxoxxxxxxxxoxxxxxxuxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxuxxxxxxxxxxuxxxxxxxuxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxoxoxoxxxoxxxxxxxxxxxoxxoxxxoxxoxxxxx",
-"oxxoxoxxxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxoxxxxxoxxxxxxxxxxxxpoxoxtuptxxxxpxxxxxxpooxxxxxxxxxxxxuuoxxxuxoxxxxupooxxxoooxoxxxxxoxxxxxuxxxxxxutxvxxxxxxxxxxxxxxxxxxxxxxxxxoxooxxxouuuxxxupouuxxuuuouuxxoxuxxxxxxxxxxououoooxxxxuuxxxxxuuxoxxxxoxxxxxxuxxxxxxuxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxoxoxxxxoxxxxxxxxxxxxxxoxxxoxxoxxoxoxx",
-"xoxxxxxxxoxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxoxoxxxxxxxxxxxxxxxxxouxxoopoouxxxxouxxxxxxpxxxxxxxxxxxotuupuxxupuuuxxopuuxxoppppupxxxxoxxxxxupuxxxxxpxpxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxtuupxxotuuoxxututupuxoxuxxxxxxxoxxoututupoxotuutoxxpuutuxxupuupxxxxuxxxxxxooxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxoxooxxoxxxxxxxxx",
-"xxxxxxoxxxxxxxoxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxoxxxoxxxxxxxuxoxxxxxoxoxxxxpxxxxxxuoxxxoxxxxxxuuuuutxxoxxxoxxxuxxxxxuoxuxuxxxxuxxxxxxxxuxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxooxxxxxxuxxuxoxuxxxxxxtxuxxuxxxoxxxxopttptxxtxuxxuxuxxxxuxuoxxxuxxpuuupxxxxoxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxoxxxxxoxxxoxxxxxxxxoxxoxxxoxoxxxox",
-"xxxoxxxoxxxxxxxoxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxoxxxxxxxxoxxxxxxuxxxoxoxoxxxxxxuoxxoxxopxxxxoxoxxopuuuuuxxoxxxooxxuxxxxxuuxoxuxxxxoxxxxuxxxuxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxuxouxxxuxxxxxxpxuxxuxoxuxxxxxxxxxxxxpxuxouxuxoxxuxuxxxxoxopuuuuoxxxuxxxxxxxuxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxoxxxxxxoxxoxxxxxxxxxoxoxxxxxxoxxx",
-"xoxxxxxxxoxxxxxxoxxxoxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxoxxoxoxxxxxoxxxxxxxxxxoooxxxxxxxoxxxxxuxxxoxxuxxxxxpuoxxopoxxxxxuxxxuxoxuxxxxxuoxuxoxxxxuxxoxoppuoxxxxxxxxxxoxxxxxxxxxxxxxxxupoxxoxxxoxoxxuxxooxxuxoxxxxtxuxouxxxuxxxxxxxxoxxxpxuxxuoouxxpoxouxxupxxpoxxxxxxxuxxxxxxuxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxoxxxoxxxxxoxxxxxxxxxxxxxxxxxxxoxxoxxxxx",
-"xxoxxoxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxooxxxoxoxxoxxxxxxpxxxoxxxxxoxxxxuoxxxxxouxxxxpuxxxxxppuoxopuxupuxxoppuoopuxpxouxpppppxxxxuxxxxxxxxxxxxxxxxxxxxxxxxxxxxopxxxxoxxxxoxppooppxoouppoxppxuoxpxuppppoxxxxxxxxppxuoxpxxoppooxxoppouuxxuppoxxxxuxxxxxxuxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxoxooxxxoxxoxxoxxxxxxxxxoxxxxxxoxxox",
-"xxxoxxxxxxoxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxoxxxxxxxoxxxxxooxxxxxxxxxxoxxxoxxxxxxoxxxxxxxxxxxxxxxxxxxoxxoxoxxxxxxxxxxxxxxxxxxxoxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxoxxoxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxoxxoxxxxxxxxoxoxoxxxxxxpxxxxxxuoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxoxxoxxxxxxxxxxxxxxxxxxoxxxoxxx",
-"xoxxxoxxoxxxoxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxoxoxoxxoxxoxxxxxxxxxxxxxxxxxxxxxxxoxxxxxoxxoxoxxxxxxoxxxxxxxxxxxxxxxxxxoxxxxxxxxoxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxoxxxoxoxxoxxoxxxxxxxxxxoxxxxxxxxxxxoxxxxxxoxxxxxxxxxxxxxxxxxxxxxxoxxoxxxxxxxxxoxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxoxoxxxxxxxxoxxxoxxoxxxxxxxoxxxxxxxox",
-"xxxoxxxxxxxxxxoxxxxxoxoxxxxxxxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxoxxxxxoxxxoxxxxxxxoxxoxxxxoxxxoxoxxxxxxxxxxxxoxxxoxoxxxxxxoxxxxoxxxxxxxxoxxxoxoxxxxoxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxoxxxxxxxxxxoxxxxxxxxxxxxxxxxoxoxxxoxxxxxxxxxxxoxxoxoxxxxxxxoxxxxxxxxxxxxxxxxxoxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxoxoxoxxxoxxxxxxxxxoxxxxxxxxxoxxx",
-"xxxxxoxxxxoxxxxxoxxxxxxoxxxxxxxxxxoxoxxxxxxxxxxxxoxooxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxoxxxxxoxoxxxoxxxxxxoxxxxxxxxxxxxxxxxxoxxxxxxxoxxxxxoxxxxoxxoxxxxoxxxoxxxxxxxxxxxxxoxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxoxxxxoxxoxxoxxxxxxxoxoxxxxxxxxxxxxxxxxoxoxxxoxxxxxxxxxxoxoxxxxxxoxxoxxxxxxxxxxxxxooxoxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxoxxxxxoxxxxxxxxxxxxxoxxxxxx",
-"oxxoxxoxoxxxoxoxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxoxoxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxoxxxxoxxxxxxxoxxxxoxxxxxoxxxxxxxxxxxoxxxxoxxoxoxxxoxxxxxoxxxxxxxxoxxxxxxxxxxxxxxxxxxoxxoxxxxxxoxoxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxoxxxxoxxxoxxxxxxxxoxxxxxxxxxxxxoxxxxoxxoxxxxoxoxxoxxoxxxxxxxxoxxxoxxxxxxxxxxxxxxxxoxxxxxxoxxoxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxoxxxxoxxxxxxxxoxxxxxxxxoxoxxxxxxxoxoxx",
-"xxxxoxxxxxoxxxxoxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxoxoxxoxxxoxxxoxxxxxxoxxxxoxxxxxxxxxxxxxxxxxxxxxoxxxxoxoxxxxoxxxxoxxoxxoxxxxxxxxxxxoxxxxoxxxxxoxxxoxxxxxxxxxxoxxxxoxxxxxxxxxxoxoxxxoxxoxxoxxxxxxxxxxxxoxxxoxxxxxxxxxxxxxxoxxoxxxxoxxxxxxxoxoxxoxxxxxoxoxoxxxxxxxxxxxxxoxxxxxxoxxoxxxxoxxxxxxxoxxxxoxxxxoxxoxxoxxxoxoxoxxxxxxxxxxxxxxxoxxxxoxxxxxxxxxxxxxxxxxxxxxoxxxxoxoxxoxxoxxxoxxxxxxoxxxxxxxxxox",
-"xoxxxxoxoxxxxxxxxxxoxxxoxxoxoxxxoxoxxxxxxxxxxoxxxxxxoxxxoxxxoxxxxxoxxxoxoxxxoxxxxxxxxxoxxxxxxoxxxxoxxxxxxxxxxxxoxxxxxxxxxoxxxxxoxxxxoxoxxxxoxxxoxxxxxxxoxxoxxxxoxxxxxoxxoxoxxxxxxoxxoxxoxxxxoxoxoxxxxxxxoxxxxoxxxxxxxxxxxxxxxxoxxxxoxxoxxxxxoxxxoxxxxoxxxoxxxxxxxxxoxxxoxoxxxxxxxxoxxxoxxxxxxxxoxxxxoxxxxxxxxxxxxxxxxxoxoxxoxoxoxxxxxxoxoxxxoxxxxxxxxxxxoxxxxoxxxxxoxxxxxxxoxxxoxxxxoxoxxxxxxxxxxxxx",
-"xxoxxxxxoxxxoxoxoxxxxoxxxxxxxoxxxxxxoxxxxxoxxxxoxoxxxoxxxxxxxoxoxxxxoxxxxxxxxoxxxxxxxxxxoxxxxxxoxxxoxxoxxoxoxoxxxoxxoxoxxxoxoxxxxxxxxxxoxoxxxxxxxxxxxxxxxxxxxxxxuoxxxxxxxxxxoxxoxxxxxoxxxxouoxxxxoxooxxxxoxxxxoxxxxxxxoxoxxxxxxoxxxxoxxxoxxxxxxxxoxxxxoxxxxxxxoxxoxxxoxxxxxoxxoxxxxxxxxxoxxoxxxxoxxxxxoxxxoxoxxoxoxoxxxxxoxxxxxxoxoxoxxxxxxxxoxxxxxxxxoxxxxxxxoxxoxxxoxxoxxxxoxxxoxxxxxoxoxxxxxxoxxx",
-"xxxxxxxxxxoxxxxxxxxxxxxxoxxoxxxxoxoxxoxoxxxxxoxxxxxoxxxoxxoxxxxxxoxxxxoxoxxoxxxxxoxxxoxxxxxxoxxxoxxxoxxxxxxxxxxxxxxxxoxxoxxxxxxxoxxxxxxxxxxoxxxoxxxoxxxoxoxoxoxxxoxoxoxoxxoxxxxxxoxoxxoxoxxxxoxoxxxoxoxoxxxoxxxxoxoxxxxxoxxoxxxoooxxxxxxxxxxoxxoxxxxoxxxoxoxoxxxxxxxxxxxxoxxxxxxxxoxxxxxxoxxxoxxxoxxoxxoxxxxxoxxxxxxoxoxxxxxoxoxxxxxxxoxoxoxxxoxxxoxxxxxxxoxxxxoxxxoxxxxxxxxxxxxxxxxxoxxxxxoxoxxxoxx",
-"xoxxoxoxxxxoxxxxxxxoxxoxxxxxxoxxxxxoxxxxoxoxxxoxoxxxoxxxoxxxoxoxxoxxxxxxxoxxxoxxxxxoxxxoxxxxxxxxxxoxxxxoxxoooxxooxxoxxooooooxoxxxooxoxxxxxxxooxoxoxxxoxoxxxxxxooxoxxxooxoxxxoxoxxxxoooxxxoxxoxxxooxoxxxxxooooxxxooxoxoxxooxxxoxxoxxoxoxoxxoxxxxxxxxxxxoxxxxxxoxoxxxxxoxxxxoxoxxxxxxoxxoxxxxoxxxoxxoxxxxxoxxoxxoxoxoxxxxoxxoxxxxoxoxxxxxxxxxoxxxxxxxxoxxxoxxxoxxxxoxxxoxoxxoxoxxoxxoxxxoxoxxxxxoxxxxx",
-"xxoxxxxxoxxxxoxxoxxxxxxxoxoxxxoxxoxxoxoxxxxoxxxxxxoxxoxxxxoxxxxxxxoxoxxoxxxoxxoxxxxxxxxxoxxoxoxxoxxxoxxxxxoxooxxxoxooxxxooxoxxxooxooxxoxoxoxxooooooxxxoxooxoxooooxoxooxoxoxoxxxxxoxxoxoxxxoxxoxxxxooxxoxoxoxooxooxooxxxxxoxxxxxxoxxxxxxxoxxxxoxxoxoxoxxxxoxoxxxxxxoxxxoxoxxxxxoxxxxxxxxxoxxxxoxxxxxxoxoxxoxxxxxxxxxoxoxxoxxxxoxxxxoxxoxxoxxxoxoxxxxxxoxxxxxxxxoxxxxoxxxxxxxxxoxxxxxxoxxxxxoxoxxxxoxx",
-"xxxxoxoxxxoxxxxxxoxxoxxxxxxoxxxxxxxxxxxoxoxxoxxoxxxoxxoxoxxoxxoxoxxxxoxxoxxxoxxoxxxxxoxxxxxxxxoxxxxxxoxoxxooxoxoxoxxoxoxxxxxoxxoxxxoxxooooooxxxxxxoxooxxoxxxoxxxxoxoxooooxxoooooxxoxoooxoxxxoxxoxxxoxxxxxoxoxxxxoxxxxoxxxoxxoxxxoxoxxoxxxxoxxxoxxxxxxoxoxxxxxoxxoxxoxxxxxxoxxxxoxoxxoxxxxoxxxxxoxoxxxxoxxxoxxoxxoxxxxxoxxoxxxxoxoxxoxxoxxoxxxxxoxoxxxxxoxxoxxxxoxxxxoxxoxoxxxxxoxoxxoxoxoxxxxoxoxxox"
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkknkkkkkkknkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkknikkkknninkkkkkkkkkkknninnnkkkkkkkkkinkkikkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkknknkkkkkkkkkknkkkkkkkknkkkkkknkkkkknkknkkkkkkkkkkkxkkkkkkknkkkkkkknkkkknknkkkkkkknkkkkknknnkkkkkkkkknkkknkkkkknkkkkkkkkkkkkknkkkkkkkkkkkkknkkkkkkkknkkkkkknkkkkknkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkknnkknnnnikkkkkkkkkknnnnkkknnnnnkkkinnikkkkkinnkkkkkkkkkkikkkkkkknkkkkkkknnkkkkkkkkkkkinnnnkkknnnkkkkkkkkkknnninnkknnnnnkkknnninkkinnnnkkkkkkkkkkinnnkkknnnnnkknnnnnkkknkxnkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkknkkknkkniiiinkknkkknkknkkknkknkkkknkknxkkkkkkkkkkkkkkkkkkkkknkkkkkkiinnkkkknkkkknnnnnxkkkkxkkkkniiiinknnknknkknkkkkkknkkkknknnnnnikkiiiiikkknkknkknkkkknkknkkkknkknikkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkknkkkkkkkkkknkkknkknkkkknknkkkknkknnikkkkkkkkkkkkkkkkkkkknkknkkikkknkkkknkkkknnnknnkkkxkikkkkkkkkkknnknknkknkkkknknkkkknkinnnnnkkkkkkkkkknkknkknkkkknkknkkkknkkinnkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkknnkknkkkxkkkkkkkkkknkkknkkinkkikknnkknnkknkkikkkkkkkkkkkkkkkkkkknkknkkikknnkkkknkkkkkxkkkkkkikkkikkkkkkkkknnknknkknnknxkknnkkinkkxkkkkkkkkkkkkkknkknkkkikknikkinkkikkknknnkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkknkknkkninnikkkkkkkknxkkixkkkixxnkkknxxnkkiikkxxkkkkkkkkkkkkkkkknxxxxxkknxxkxnkkixxnkkkkxxikknxiknxnkkkkkkknxikxknnkkixikkkknxikxnkkixikkkkkkkkkkixkkxxkkkixnkkkkixxkkkxnknxikkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkknkkknkkkkkkkkknknkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkknkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkknkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkknkkkkkkkkkkknkkkkkknkkkkkkkkkkkknkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkknkkkkkkkkknkknkkkkkkkkkkkkknkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkknkkkkkkkkkkknkknkkkkkkkkkkkkknkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkknknkkkkkkkkkkkknkkkkkkkkkknkknkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkknkkkkkkkkkknkkkkkkkkkknkknkkkkkkkkkkknkkkkkkkkkkkkkkknkkkkkkkkknkkkknkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkknkkkkkkkkkkkkkknkkkkkkkkkkkknkkkkkkkkkkkkknkkkkkkkkkkkkkknkkkkkkkkknkkkknkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkknknkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkknknknkkkkknkknkkkkkkkkkkkkkknkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkknknkkkkkknkknkkkkkkkkkkkkkknknknkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkknkkkkknkknkkkkkkkknkkkkkkkkkkkkkkkkknkkkknkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkknknkkknkkkkkkknknknkkkkknkknkknkknkknkkkkkkkknkkkkkkkkkkkkkkkkknkkkkkkkknknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkknkkkkknkkknkknkkkkkkkknknknkkkkkkkknkkkkknkknkkkkkkkknkkkkkkkkkkkkkkkkknkkkkkkkknknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkknkknknknkknkkkkkkkkkkkkkkkkkkkkkknkkkknkkkknkknuunnkknkkkknkkknkkkkntkkkkkkkkkkiikkkkkkknkkkkkknkkkknnkkkknnkkknkkkkkkkkkkkkkkkknkknkknkkknknkkkknkkkkkkkkkkkkkkknkknkknkkkkkkknkknkknknkknknkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkknkkkkkkkkkkkknkkkkkkkkkkkkkkkkknkknknkkkknkkkkkknkkkkkkkkkkkkkkknkknkknkkkkkkknkknkknknkknknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkknkknkkkknkkkknkkkkkkkkkkkknkkkkkkkkkknktnkkkkiknkkkknkkkkkkkkkkkkikkkkkkkkkkkinkkknkkkkknkkkknknkkukkkktkknkknkkkkkkknknkknkkkknknknknkkkkkkkkkkkkkkkkkkkknkkkkkkkkkknkknkkkknkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkknkknkkkknkkknknkkknknknkkkkkknknknkknkkkknkknknkknkkkkkkkkkkkkkkkkknkkkkkkkkkknkknkkkknkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkknkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkknknkkkkkknknkkkkkkkknkknkkknkkkkkknkkkkkkkkktkkkknikkknnkixnknininnnkkxkninkkkkiikikknniikkkkknkkkkkkkxnknkkiikkknknkkkkkkknkkkknkknkkkkkknknknkkkkknkknkkknkkkkkknkkkkkkkkkkkkkkkknkknkknkkknkkknkkkkkkkkkkkkkkkkkkkkkknkkkkknkknkkkknkkkkknkkkkknkkkkkkkknkkknkknknkkkkknkknkkkkkknkknkkknkkkkkknkkkkkkkkkkkkkkkknkknkknkkknkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkknkknnknkkknnkkkkkkknkkkkkkkkknkkknkkkkkkknnknkkkxnkkkknixtkkxuxuxxikitxiukkktiiuxkknixxikkkkknkkknkktkkkkkktkkkkkkkkkkknkkknknkkkknknknkkknkkkkkkkknkkkkkkkkknkkknkkkkkkkkkknknknkkknkkknkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkknkknkkkkkknkkkkknkknkknknnkkknkkkkkkkknkkkkkkkkknkkknkkkkkkkkkknknknkkknkkknkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkknkkkkkkkkkkkknkkkkkkkkknknkknkkknkkknknkknknkkkxkkkkkkxknknkiuuukknukxkkxkxnkkktkikkkkxkkktutikknkkknknkkkxknknkkxnknkknknkkkkknkkkknknkkkkknkkkkkkkkkknknkknkkknkkknknkknknkkkkkkkkkkknnkkknkkknkkknkkknkkkkkkkkkkkkkkkkkkkkkkknkknkknkkknknknknkkkkkkknkkkkkknnkkkkkkkknkkknkkkkkkkkknknkknkkknkkknknkknknkkkkkkkkkkknnkkknkkknkkknkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknkkkkkkkknkkkkkkkkknknkkkkkxkkkknkxknkkntnktnkkwkxkkxkxkkkkxkxkkkkxkkxnknxkkkkkkkkknkkxnkkkkkxkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknkkkkkkkkknkkkkkkkknkkkkkknkkkkknkkknknkkknkkknkkkkkkknkkkkkkkkkkkkkkkknkkkkkkkkkkknkkknkkkkknkknkkkknkkkkkkkkkknkkkkkkkkkkkkknknkkkkkkkkknkkkkkkkknkkkkkknkkkkknkkknknkkknkkknkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkknnknnkxknkknxkknkxkkkwknkwkxkkxkxunkxnkntkkttkktkkixkkkknkkkknkktkknknnxkknkknknknkkkkkknkkkknknkkkkkkkkkknkkkkkkkkkkkkkkkkkkkknknkknkknkkknkkkkkkkkkknkkkknknkkkknkkkkkkkkkkkkkkkkkkkknkknkknknkkknkkkkkkkkknkknkkkkkkknkkknkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkknknkknkknkkknkkkkkkkkkknkkkknknkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknkkkkunkkxwwwwikkuwunwkwwktikwnwnwwnkkknwwittkiwwnwnnkkkknkkkkkntkkkktnnkknkkkknknknnnnnnnnnnnnnkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknnkkkkkknkknnkknkkknkknknkkkknkkkkkkkkkkknknkkkkkknkkkkkkkkkkkknkknknnnknknkkknknknknnkkknknknknkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknnkkkkkknkknnkknkkknkknknkkkknkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkrrrrrrrrrbrrrrrrbrrrrrrrrrrrrrikinnkkknirrrrrrrrbrbrbrrbrrriknkkkkkkrrrrrrrrrrrrrrbrrrbrbrrrrbrrrrrrrrrrrrrrrrrrssssssgsggbkkkkkkknkkkkkkkkkknknkknkkkkkknkkkkkkknkkkkknknkkkkkkkkknknkkknknknkkkkkkkkknkkknkknknknknknkkknknkkkknknkknkknknkknkknknkkkkkkkkkkkkkknkkkkkkkkkknknkknkkkkkknkkkkkkknkkkkknknkkkkkkkkknknkkknknknkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkrhhhqhhhhhhhhhhhhhhhhhhhhhhhhhhmkkknkkkivhhhhhhhhhhhhhhhhhhhmknknkkkrhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhtnknkkkknnkkkkkkkkkkkkknkkkkkkknkkknkkknknkkkkknknkkkkkkknnnkknkkkknknkkkknkknkkkkkkkkkkkkkknkkknknnkknknkkknkknknkkkkkkkkkkknknnkknkkkknnkkkkkkkkkkkkknkkkkkkknkkknkkknknkkkkknknkkkkkkknnnkkknkkknknkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkknknknkkihhhhhhhhhhhhhhhhhhhhhhhhhhhhhhodknkkkknvhhhhhhhhhhhhhhhhhhhockkkkkkihhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhoenkkknnkkkkknkknknkknkknknnknkkkkkkkkkknkknkknkkkkknknkkkkkknkknknkkkkkkkkkkkkknnkknknknnkknknknkkkknkknknkkkkknkknnnkknnkkknkknknkkknnkkkkknkknkkknknkknnnkkkkkkkkkkkknkknkknkkkkknknkkkkkknkkkknkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkknkkknkkmohhhhhhhhhhhhhhhhhhhhhhhhhoooldkknknkkbhohhhhhhhhhhhhhhhholdnknnkkkmohhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhlcnknknkkkkknkkkkkkknknknknkkkkkkknkknnkkkknkkkknnkkkkkkknknkknkkkkknknnkkkkknkkknnkkkkkknknkknknknknknknknknknkknkkknkkkknnkknknknknknkkkkknkkkkknknkknkkknknkkkknkknnkkkknkkkknnkkkkkkknknknnknkkknknnkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkknkknkkkdpllhhhhhhhhhhhhhhhhhhholeepddwnkknknkkwdddqhhhhhhhhhhooeepwknkkknkkddjeoqhhhhhhhhhhhhhhhhhhleeeeeeelloohhhhhhhhhhhhhhhhl`nnnnknknknknnknknkknkkkkkknkknkkkkkkknknkkkkkkknnnknknkkknnkkknnnkkkkkkknkkkknkkknkkkkkkkknknkkknkkkknkkknkkknknkknnknkkkkkkkknknknkkknknknknknkkkknkkkkkkkkknkkkkkkknknkkkkkkknnnknknkkknkkkknknkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkknkx`fhhhhhhhhhhhhhhhhledtnnknnnnnnnnnkkkknshhhhhhhhhlej`nnnnniknknkkkkknghhhhhhhhhhhhhhhhoel`xnninitwudplohhhhhhhhhhhhheunnnnnnnknknkknkknnnkkknknkkkkkkkkkknkknkknnnkkkkkkkkkkkkkkkknkkkknnknkkkkkkkkkkkkknkkknkkkkkknnkkkknkkknknnnkkkkkkkkknkkknknkkkkkkknkkknknknknknnnnknknnknkkkkkkkkknkknkknnnkkkkkkkkkkkkknknkkknknnknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknnmhhhhhhhhhhhhhhhlcxxiixixxxxiinnnkkkighhhhhhhheeaxxxxxxxiiinnknkknnivhhhhhhhhhhhhhhhejxxixxxxxxxxxii`dohhhhhhhhhhoetxtxxinnnnknknknknknnnknkknknkkkknkkkknknnkkkkkkkknkkknkknknknknknkknknknnkkkkknkkkknkkknnknknkkknkkkknknkkknknknknkkkknkkkkkknknkkkkkkkkknknknkknknnknkkknknkkknkkkkknknnkkkkkkkknkkknkknkknknkkkkknkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkknkkkkknkkkkkkkkkkkkknirfhhhhhhhhhhhhhhecuuwwuuuuuuutxnnnkkrvhhhhhhoeewuwwwuuuuutxxnnknkknrvhhhhhhhhhhhhhhoewwuwuuuwuuwuwuuuuwdqhhhhhhhhoew`wwwuxnnnkknkkknknknknknkkkkknnkknkkkknknnknnknkkkkknkkkkkkkknknkkkkkkkkknknkkkknkkkkkkknkknkknkkknknkkknnknnnkknkkkknknkkknkkkkknkkkkknkkkknkkknkknnknnkkkkknkknknkkknknnknnknkkkkknkkkkkkkkknnnkkknkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkknknitshhhhhhhhhhhhhhlcccccaaaa``wuxinnkrbhhhhhhoejdccaacacaaa`utxnnkknnrvhhhhhhhhhhhhhhllccaccaaaaaaaaaaaaaaaqhhhhhhhljcdcca`txnkkkkkkknknkkkkkknnnknkknnnknkkkkkkkknkkknnkkknkknknkkkkkknkknnkkkknkknkkkkkkkkkkknkknknnknkknknkknkknknknknkknknkkkknknkkkkkkkkkkkkkkknknnkkkkkknnnknkknnnkkkkkkkkkknkkknnkkknkknknknkkkkkkkknkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkniughhhhhhhhhhhhhhljjpjpppdcaa`utxnnirfhhhhhoeejjpjpjpppddcaaccxnkkinrhhhhhhhhhhhhhhhejjpjppppjpccaccccccddvqhhhhhheejjjjpawxinkkkknkkknknnnnnkknknknkknknnkknkknknknnkknkkkkknkknknkkkkkkuukknkkkkknkkkkkkkknkkknnkkkknkkknknknknkknknknkkkkknkkkkkknknnkkkkknkkkknkkkknknnnkknknknnknknnnkknkknknknnkknkkkkknkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknnituvhhhhhhhhhhhhhoeeejejpdca`wuxinnrmhhhhhoelpjejejejjjdda`ctnkkkkxnrhhhhhhhhhhhhhhoeeeeejejpdpcaaa`aaaccddmhhhhhheeeeejpc`cdannknknkknknxa`cackknknnnnkccnkcaknkkknknkkkknkkknknkkkkkkkkktkkkkkkkkknkkkkkkkkkknkkkknkknkkkkkknknknknkkkknknknkknkkkkkkkkkkkkkknknknknknknknkkkknknknnknknnkkkknkkknknkkkkkkkknknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkniitshhhhhhhhhhhhhheeeejjpc`wutxinnrshhhhhoejcdpeeeeeejpc`aaautnnkttishhhhhhhhhhhhhhleeeeeeljpccwaa`uwwacaacsqhhhhoeeeeeejcwxunknkkkittkkktkntktnknxtinknndknwnkkkknknktitniikkkntxkkkkkxxkxkkkitxkkkknknkknxxxkxnnnkitxknntkttnknknknknnkkknkknkkknknkkkkkkknknkkkkknkkknknknnkknknnknknnknknnkkknkknnkkkknkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknknnirhhhhhhhhhhhhhheeeeepc`utxxinnighhhhhoepcapjeeeeejjp`wwwatxkknt`rmhhhhhhhhhhhhhhleeeeeejpc`ata`uxxca`ccwwmhhhhleeeeejpawxunkknkktttwnnkkktkkkn`uuu`nknn`cknnnkkkkkkt`xaxuikn`xx`nkk`ttaukk`uxw`nkkkkkkknwuu`xwknntxuiki``ut`xkknkknknnnknkkkkknkkkkkkkknkkkknnkknkknnkkkkkknknnknnnnknknnknnkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkknknnknivhhhhhhhhhhhhhleeejpauxinnnnrbqhhhhoedwiwapjeeejjdjtxinunnnkkktrfhhhhhhhhhhhhhheeeeeeeejwuwctnnni`uuwcutshhhheeeeeejpauxuknnknkua`uknnkktnknn`ttuaxknn`wknkxaaacakkckxkkxkxkkkktktnkkkwki`ttxaxnwaaa`tkttntktkkn`autkktnknkwkknknkkkkkkknknkknkkkkkkkknnnknkknkknknknnkknkknkknknknnnnknknnkkknnkkknkkkkkkkkkkkkkknkkkkkknkkknkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkknkkkkkkkkkkknknknkknknknshhhhhhhhhhhhhoeeejd`uinnkkrrqhhhhhednuxucpejejpda`xinntnkknnkxrhhhhhhhhhhhhhhoeeeeeejpaux`x`nnnx`ttuuiighhhheleeeejp`tiunkntktxnnwkknkntknkx`ttttnnkwxttkkkkkkkkknaktkktktkkkktktknnktkx`ttttnkknkkkkkxxkuntnkunkntkkunknkwnkkknkknknnknknknknkknnknkkknknnnknknnkknknknknknnnknkkkknkkkkkknkkkkknkkkkkkkkkkkkkkkkknkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkknknkkkkkknknknknkbhhhhhhhhhhhhhheeejd`tinknrbqhhhhoejnnu`wdjejjjauxxnnnkuknkknnbshhhhhhhhhhhhhhleeeeeejc`titni`knkcxkniknrhhhoepjeeejd`titnknukwkkn`nknkktkknncxkknkktxnkcnknkkknkkkaktkktkitkkuxkn`knw`nkaxnnnnkkkkkkkktxntntnnukktxkkx`nkuinnnknknknkkkknnkkkknnkkknnknknkknkkkkkknknkkkkknknkkkkkkkknnknkkkkkkkkkkkkkkkkkkkknkknkkknnkknkknkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkknknknnknknkkknnnfhhhhhhhhhhhhhleejd`tnkkibqhhhhheeinnxajjjepdadd`xknwcccwkntarmhhhhhhhhhhhhhheeeeeeepcwx`unkcanknwcwxknrhhhoecpeeepcwwccccaxkicctuwkntcccnnknwa`xkkaakkackkknkknnaakuikakkiacxknknacxwwnnua`xnknkkkkkiawkanxwkuccicxktn`ciknkknknknknknkkkkknkknnnknnknnnnnkknnnkknknknknnnknnknknkkkkkkkkknknknnkkkkkkkkkkkkkkkkknknknkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkknkkknnknkknmhhhhhhhhhhhhhoeejpauxnirfhhhhoeltxnit`cpjpd`utnnkknnnknknkknrqhhhhhhhhhhhhhoeeeeeejpauxknkknnknknknnkkrhhhld`djjjpcwxnnknknnknknknkknkkknkknnnnnkknknkkkknkknkkknkkkkkkkkkkkkkkkkknnnkkknkknkkkkkkkkkkkkkknnnkkkknnktkkknkknnnknnkknkknkknkknkkknkknnkkkknnnnknnnknknkknknknnnknkkkknkkkknkkkkkknkkkkkkkkkkkknkkkkknkknknkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkknkkkkkkknknknnknkknknknbhhhhhhhhhhhhhheeepcuxirvhhhhheliknxtwcpppcawxinknknknnknknknbhhhhhhhhhhhhhhoeeeeeejp`unkkkkkknknknknknghhhe`wcpjjpattnnnnnkknknknknnknkknnkknkkknkkkkkkkknknkknkkknkkkkkkkinknknkknknnnknkknknkkkkkkkkkkknkknknnkknxpctkkkkkkknkknnknnkknnkknknknnnknnnnnkkkkknknkknknkknnkknknknnkkkkkkknknnknkknkkkkkkkknnknkknknknknkkknkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkknkkkknnkkkkkkkknknknnkkkkkiqhhhhhhhhhhhhhleejcwrrvhhhhheennnitwadppc`utxnnnkkknknnknnkrshhhhhhhhhhhhhhleeeeeejdwuxinkknnnnknnknnnnmohetuapjjd`xxnnknnknkknknknknnnkknknknknknnkknknnkknnknknkkkkknkkkknnnknkknnknnknnknkknkkknnknkkkkknnnknknknknnnkkkkkkknnnknnnnnknnnkknkknkknnnnnnnnnkknknnnknnkknknkknkknnkkknnnknknkknkkkkkkkkkkkknknkkkknknkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkknkkkkkkkkknkknkkkknknkkknnnknmhhhhhhhhhhhhhoeejdtrvhhhhhelnnnitwadppd`uxnnnknnnnknnnknkkrvhhhhhhhhhhhhhheeeeeeepcwxinnknrgvbrknnnnknncjlit`dppcwxnnnnknknnnknkknkknknknknnnnkkkknnnnkknnkkknkkknkkknkkkknnnnnnknknnnnknkkkkknknkkkkkkkkkkkknnkknnnnnnnknkkkkkknnnknnkkknknnknnkkkknknkkkknnknkkkknkknnnnninnkkkkknkkkknknknkknkknkknkkkknnnnknkkkknnkknnnkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknkkkkknghhhhhhhhhhhhhheeesrvhhhhoeeinnxtwadppcawtikkkkkkknkknnknknrhhhhhhhhhhhhhhoeeeeeejp`uxnnnnnrqhhwxknnknnkkkkixwapdauinnknknkkknknnniirnikkknkknnniirrggsgikknnnknnkknkkknirrrgsggnnknkknknkkkkkknkkkknkkkkkkknknknirrbsssbnnnnkkkknnnnniiiikkkkkkkkkkknnknnnkknknnnnnnirrrsssggrnnnkkknkkknknnknknnkknkknrrrbsgsgrnnnkkkknrsgrkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknnkkknnknnhhhhhhhhhhhhhhlewrvhhhhhelinnitwadppdawtinkkkknkkknkknknknghhhhhhhhhhhhhhoeeeeeejd`tiinknrshhhetkkkkkkkkknnxwcdd`uiknknnnnniiirrrssvqsikkkkknkrrgvhhhhhhminknknknknnknrbmqhhhhhhmiknknknknnnknkkknnknkkkkkkkkirrsvhhhhhhqgkknnrrrgssgssvmsnknkkknkkkknnnkkkknknknirbsmqhhhhhhhfsrkkkknkkknknnnkknknnnrbmfhhhhhhhfsrnnknrghhhtkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknkkkkknnfhhhhhhhhhhhhhoprvhhhhheennnxtwaddpdawxiinkkkkkknknknkknnrmhhhhhhhhhhhhhheeeeeeejcwxinnkirqhhoekkkkkkkkkkknxuaccwxrrrrrrssssvvfhhhhhhlankkkkirgqhhhhhhhhhqxnnknknkknrbmhhhhhhhhhhhgknkknnkkknknnkkkknkkkkkknrrsqhhhhhhhhhhfnkrshhhhhhhhhhdakknkkknkkkknnnknkkknrrgvhhhhhhhhhhhhhhmnknknnknknknnnkknrbmhhhhhhhhhhhhqvsbrgqhhoekkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknnknknghhhhhhhhhhhhhhrshhhhhelinnitwacppdawxinnnnkkkkkkkkkkknkkrfhhhhhhhhhhhhhheeeeeejpcuxinnirmhhhopkkkkkkkkkkknit`aaugvfhhhhhqhhhhhhhhhhhetnnknrrvhhhhhhhhhhhhhinnnknnnrsqhhhhhhhhhhhhhwknkknknknkknknknkknkkkirsqhhhhhhhhhhhhhdnrfhhhhhhhhhhlakkkknkkknkkkknnnnnirgfhhhhhhhhhhhhhhhhhfnnkkknknnknknknrsqhhhhhhhhhhhhhhhhhhhhhhodkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknkkrhhhhhhhhhhhhhhshhhhheeinnituadppdawtinkknwctkkkkkkxkkkknrhhhhhhhhhhhhhhoeeeeeejp`uinnnrghhhhlankni`dxkknknixw`wxshhhhhhhhhhhhhhhhhhljnnnnibqhhhhhhhhhhhhhqonntnnirshhhhhhhhhhhhhhhhwcxnknknknknkkkknkknkrbvhhhhhhhhhhhhhhqhurhhhhhhhhhhhexkknxcwkkkkkkkkkknrbmhhhhhhholeedqhhhhhhhqnnnnknknnnnnnrshhhhhhhholeeelhhhhhhhhhhlckkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknnknnvhhhhhhhhhhhhhhhhhhlexnnixwacdpda`uxnnkkkukknkkkkiwknkkrghhhhhhhhhhhhhhleeeeeejdwxinnrrqhhhhexkniiiiwnkkknnxtutxghhhhhhhhhhhhhhhhhheanknrrqhhhhhhhhhhhhhhho`i`iirvhhhhhhhhhhhhhhhhhlpnknnwdpaknnknkknknrbqhhhhhhhhhoeeehhhhvshhhhhhhhhhoennknnkukkkkkkkknnrsqhhhhhhhlepuxnshhhhhhhhonknnknnknknrgqhhhhhhhledunkiwfhhhhhhhhlwnknnknkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknknnmhhhhhhhhhhhhhhhhhlecxiitu`ddpdawtxnnkkkkunkknkkk`kkkkkrvhhhhhhhhhhhhhheeeeeeejpwtnxrbqhhhhoeuinxttt`nnnkknnxxixrcllhhhhhhhhhhhhhhhetiurbqhhhhhhhhhhhhhhhhhjtxwrshhhhhhhhhhhhhhhhhhoaxinnnkuknknknxtxnrshhhhhhhhhheecxxumhhvvhhhhhhhhhhljtxiiinwknknnkttirshhhhhhhhledtnirmhhhhhhhhhpxnnitiutnnrqhhhhhhhoewnniituxvhhhhhhheuniixxinknknkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknkknkkkkkkkkknkkrhhhhhhhhhhhhhhhhlepwtttu`cpddawuxiinnkkktknkknnkwkkkk`rqhhhhhhhhhhhhhheeeeeeejduxrrsqhhhhhlpudtuw`wainnknknnninxwccashhhhhhhhhhhhoextrbqhhhhhhhhhhhhhhhhhhewurshhhhhhhhhhhhhhhhhhhodttxnnnunknknnuturshhhhhhhhhheedwxtuwfhqhhhhhhhhhhhedacxtttwinnkndubrvhhhhhhhhledw`crbqhhhhhhhhhld`xxaauuwrshhhhhhhhepuiitu`c``qhhhhhhexix`wuuinnininnkkknkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknnkknkkkkkkniqhhhhhhhhhhhhhhlejd`wuwacdpdawtxinnnnknktknnkknkunnnxibhhhhhhhhhhhhhhoeeeepdcwtrrgfhhhhhhhl`iiaw`awainnnkkkknknknwnnrhhhhhhhhhhhhljubbqhhhoelvhhhhhhhhhhhhecrghhhhoeeqhhhhhhhhhhhhojawutxnuknknkna`rghhhhhhhhhoee``ju```shhhhhhhhhhhhoew`awwwuainnnunirvhhhhhhhhoedwwwprmhhhhhhhhhhopjtxwnnntrqhhhhhhhhetwuww`adccshhhhhoeutu``wttnkikkkkkknkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkknkkkkkknkknkknknknkkkkknshhhhhhhhhhhhhoeeedc``adppda`txinnnkkkkntkknnknnunknuishhhhhhhhhhhhhhsrbrrrsssmvhhhhhhhhhhetitaacc``innknknkkknnnukkrhhhhhhhhhhhhedgrfhhhlectbhhhhhhhhhhhoegbqhhheecitmhhhhhhhhhhhoepcautiwnkunkwirshhhhhhhhhhleaaadacpdshhhhhhhhhhhhlecddccawaxnnntirvhhhhhhhhhedc`aa`rhhhhhhhhhhhoep`u`xnntghhhhhhhhhex``ccdppddwfhhhhoea``ccawunniknkkkknknkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkknkkknkknkkghhhhhhhhhhhhhheeejpccddddawuxinnnnnnkkkukkknnknwnnnnrfhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhoeitcccda``inknknknkkkkkunirhhhhhhhhhhhoecrvhhoeecxirhhhhhhhhhhhocrfhhheexnnbshhhhhhhhhhhlejjdauxwnkuknwrshhhhhhhhhhoejw`adpjlashhhhhhhhhhhhejjjejjd`axnnnrrvhhhhhhhhheexp`wa`shhhhhhhhhhhoepdaaxnnbshhhhhhhhhewdcpjjjjdcamhhhhoedddpdcwunkxkkkkkknkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkknkknknnkkkknkrqhhhhhhhhhhhhhleejjppppdcwtxnknkknkkkkkukkknknnwiknkrhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhlpdjacdpjjpd`kknnnkkkkwcddgshhhhhhhhhhhlershhheedpxtbhhhhhhhhhhhorshhheeuinnrmhhhhhhhhhhhleeejdppddddnkrbqhhhhhhhhhhed`pjejjeewshhhhhhhhhhhheeeeejjejppdnnrvhhhhhhhhhoeutwpjlcshhhhhhhhhhhoejjpjdxtgvhhhhhhhhhljjejljjjpp`ghhhhlepjjejcawnxxknkknkkknkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkknknkknnnkkknnmhhhhhhhhhhhhhoeeeejjjdc`txnnnnnnnnnkkkwunkkkknk`nnrghhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhewuwcdpdauxnnnnkknknnkkkkkimhhhhhhhhhhhegbhhheedwtirshhhhhhhhhhhsghhoeeauxxwrfhhhhhhhhhhheeeejpcwxnnnnirqhhhhhhhhhhlewadjjjeljsvhhhhhhhhhhhleeeeeejdatikkrshhhhhhhhhhepu`adpjpshhhhhhhhhhheeejpc`tirvhhhhhhhhhhjjjeejdawttrfhhhljjjejpdwxnkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkknkkknkkkkghhhhhhhhhhhhhheeeejjpcwuxinknkknknkkkkxuinkknknnnkrmhhhhhhhhhhhhhhlelllloohhhhhhhhhhhhoewwcpjjdatxnkkkkknkkknknkkrvhhhhhhhhhhodrfhheejcwtxrmhhhhhhhhhhhrqhhlejawxtubhhhhhhhhhhhheeeeejd`tnkknrvhhhhhhhhhhoeccdjeeejjpbvhhhhhhhhhhhleeeeeejc`tinrbhhhhhhhhhhoeu`cpjjljahhhhhhhhhhoeeeeepawxivhhhhhhhhhhoeeejpawtxiimhhhejjeeepcwxnkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknknkknkkkrqhhhhhhhhhhhhhleeejjc`uxnnnknnnnkkkknnnknnkkkknknnrfhhhhhhhhhhhhhheeeeeeeelllhhhhhhhhhol`cpjjjd`tiknnnkkknknknkknrhhhhhhhhhhhorshhlelpauxxrfhhhhhhhhhhmmhhleepcwtxrmhhhhhhhhhhhoeeeeejd`txnnrshhhhhhhhhhhejcpjjeeejpcrqhhhhhhhhhhheeeeeejjcwxnirqhhhhhhhhhhep`cpjeejpdvhhhhhhhhheeeeejjcwtrvhhhhhhhhhhqeeejd`tinnnshhheadjejpcuxnkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkknkkkknkknkkkkkrvhhhhhhhhhhhhhoeeejpauxinnnnkkkknkkkknnnnknkknnnknrhhhhhhhhhhhhhhoeeeeeeepc`uaqhhhhhhhljdpjljjcwxnnkknknkkkkkknnnshhhhhhhhhhhbghhoeejd`uxtbhhhhhhhhhhhshhoeeepcwutrfhhhhhhhhhhhleeeeejpatxnnbqhhhhhhhhhhoedpjeeeejpcurhhhhhhhhhhhoeeeeeeedauinrmhhhhhhhhhhoecdpjejejd`ufhhhhhhhleeeeeejd`tifhhhhhhhhhhhheejcwtinkkkhhoe`cjjepauinkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkknnknknibqhhhhhhhhhhhhhheeejc`tinkkkkkkkkkkknnknknnnnkkknnishhhhhhhhhhhhhhleeeeeeejdawwuvhhhhhhejpeeelpcwxnnknkkknknknknkrmhhhhhhhhhhqrhhheeepcwutrshhhhhhhhhhfqhheeejpawugbhhhhhhhhhhhheeeeeejd`uinrmhhhhhhhhhhhlepjeeeejjd`bshhhhhhhhhhhleeeeeejdwtirbhhhhhhhhhhhlecjjeeejpawxicooooleeeeeeeejd`tishhhhhhhhhhhhpejdwxnnnnkneejwapjjd`tinkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkknkkkkknkkkkkkkkkknknnknkkkkknkkirvhhhhhhhhhhhhhhhleejdwxnnkknkknnkknnnnkknnknknkkkkrvhhhhhhhhhhhhhheeeeeeeejpdaaashhhhhoeeeeeejpauinknknkkknkkkkknrfhhhhhhhhhhmmhhleejdauturvhhhhhhhhhhqhhoeeeepd``tshhhhhhhhhhhheeeeeejp`tirghhhhhhhhhhhoejjeeeeejdauxmhhhhhhhhhhheeeeeeepcwxnrfhhhhhhhhhhhepjleeejpcwxnkkncppleeeeeeeejdwtibhhhhhhhhhhhhhjjd`xnkkkkknnit`dpjd`tnnkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknkkkkkkrrvhhhhhhhhhhhhhhhhleejd`tnnkkknnknnkkknnkknnnnnnkkkkrqhhhhhhhhhhhhhoeeeeeeejjpdddc`vhhhhleeeeeejd`tnnnkkkknkknknkknrhhhhhhhhhhhshhoeeejdawwwrhhhhhhhhhhhhhoeeeejpda`rfhhhhhhhhhhhleeeeeejdwtirfhhhhhhhhhhhlejeeeeejpawxrvhhhhhhhhhhoeeeeeeepauxrghhhhhhhhhhhlejjeeeejd`uxinnnntwcpeeeeeeejdwxnrhhhhhhhhhhhhhhjp`unnknkknknxucppcwtnnkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkknkkkknkkkkkkknknkkkkirvhhhhhhhhhhhhhhhhhheejp`uinknkknnknnnkknkkknknknnnknbhhhhhhhhhhhhhhoeeeeeeejpdcccc`mhhhhleeeeeepcwtiknknknnkkknkknnshhhhhhhhhhffhheeeepdaw`gghhhhhhhhhhhhhleeeejjdcwbhhhhhhhhhhhhleeeeeepcwxrghhhhhhhhhhhoeleeeeeepc`xxrhhhhhhhhhhhleeeeeejd`tirfhhhhhhhhhhhlejeeeeepcwtinnkinxwcpjeeeeejpawxnnmhhhhhhhhhhhhhhjcwxnkknkknniu`ddcuxnkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkknknkknkkknrvhhhhhhhhhhhhhhhhhhheeepcuinnnkkntknnnknnkkknnknnkknimhhhhhhhhhhhhhhleeeeeeeejcwwwaushhhoeeeeeejepwxnnnknknknnknkkkrvhhhhhhhhhhqhhleeeepca``bmhhhhhhhhhhhhoeeeeejppdbmhhhhhhhhhhhoeeeeeeejawxrfhhhhhhhhhhhleeeeeeejpauxrghhhhhhhhhhheeeeeeejdwtrghhhhhhhhhhhhejeeeeejdauinnknnixuadjeeeejjd`uinkrhhhhhhhhhhhhhhqd`uinkkkkkkitwac`uinnkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkknnknnrshhhhhdfhhhhhhhhhhhhhoeejc`xnnknkainnnnnkkikkkknkknkurvhhhhhhhhhhhhhheeeeeeejdawuttwbshhhoeejeeejdcuxnkknknknkkkknknrqhhhhhhhhhhhhheeeejpcaawrqhhhhhhhhhhhhleeeeeljjarqhhhhhhhhhhhoeeeeeejpaurghhhhhhhhhhhheeeeeeeepcwxirmhhhhhhhhhhheeeeeeepcuxrmhhhhhhhhhhhleeeeeeepdwxinnnkknitwcdjjjjpd`uxinnnmhhhhhhhhhhhhhhqcwxnnnnknnnxu``wtikkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkknkkkkkkkkkknkkkkkkkkkkknrshhhhhljmhhhhhhhhhhhhhoeejdatinknkanknnnuunkkxxknuini`rhhhhhhhhhhhhhhoeeeeeejed`tiiwwishhhljjjeeejdcxinnnkkkkkiuxukuighhhhhhhhhhhhhoeeeeejcaagghhhhhhhhhhhhoeeeeeejjjwghhhhhhhhhhhheeeeeeejd`trfhhhhhhhhhhhoeeeeeeejpauxnrqhhhhhhhhhhleeeeeejd`uirhhhhhhhhhhhhleeeeeejpawxnkknkknnxuwccdddcautinkkkrqhhhhhhhhhhhhhhpauxnknkkknixuutxnnkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkknknknknrshhhhhletrhhhhhhhhhhhhhheeepcuxnkkxxknnkwutwkntwnnutnnsghhhhhhhhhhhhhhoeeeeeeejd`xinuanshhhedppjejpccxnnnnnnnknna`waubmhhhhhhhhhhhhheeeeejepcabmhhhhhhhhhhhhleeeeeejjdbmhhhhhhhhhhhheeeeeeejcwrbhhhhhhhhhhhheeeeeeeejcwtinghhhhhhhhhhhleeeeeejdwtrshhhhhhhhhhhheeeeeeejcatinnkknknnnitu``a`wuxinkkkknghhhhhhhhhhhhhhqp`tinknkkknnxxinnkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkknknknkkkkkknkkkkkknkkrshhhhhleukrqhhhhhhhhhhhhhleejc`tnnkukkknn`da`kknunknuknrmhhhhhhhhhhhhhhleeeeeejpwxinnntishhheuccjjjpacinknwdddd`ktukukrvhhhhhhhhhhhhleeeeeejec`rqhhhhhhhhhhhoeeeeeeelparqhhhhhhhhhhhleeeeeejpawrmhhhhhhhhhhhheeeeeeejpauiirmhhhhhhhhhhheeeeeeejcwxrvhhhhhhhhhhhoeeeeeejpautinknknkknnnnxtttutxinnkkkkkkfhhhhhhhhhhhhhhhd`tnnnknknnnnnnkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknrbqhhhhleuknnmhhhhhhhhhhhhhheejpauinkuknkkutnnwnknunkkunkrfhhhhhhhhhhhhhheeeeeejjpwxnnnkunmhhlexcapjjd``inkknnnknknutkunrhhhhhhhhhhhhhleeeeejjjcughhhhhhhhhhhhleeeeeeejpgghhhhhhhhhhhhleeeeeejd`trqhhhhhhhhhhhleeeeeeejc`tinrqhhhhhhhhhhoeeeeeejpauirhhhhhhhhhhhhoeeeeeejp`tninnkknknkknnnnxiiinnnnknnknknqhhhhhhhhhhhhhhjawtnknkkkknknkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkknknknkkkkkkknkkkkibqhhhhoe`knnxghhhhhhhhhhhhhheeepcwxiniuknk`kkiaknn`nnuuknrhhhhhhhhhhhhhhoeeeeeejdduinnknukgqhlan``dppcw`irikknnnnnnuuktnshhhhhhhhhhhhoeeeeeejjdabshhhhhhhhhhhheeeeeeeejdbmhhhhhhhhhhhoeeeeeeejc`bghhhhhhhhhhhheeeeeeejpcuxnighhhhhhhhhhhleeeeeejd`uighhhhhhhhhhhhleeeeeejc`tnkknknkknkknkkknnnnnnnnnknknkkrqhhhhhhhhhhhhhhjautnknkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkknrbqhhhhoedniniusfhhhhhhhhhhhhhleepc`tinnakkkidcuwwnnicdxdtishhhhhhhhhhhhhhleeeeeeejjpankucddcadejppjjddjpdbsqmnkkknnxd`kdrmhhhhhhhhhhhhleeeeeeeec`rfhhhhhhhhhhhlleeeeeejd`rqhhhhhhhhhhhoeeeeeeepaurshhhhhhhhhhhheeeeeeejd`tinrmhhhhhhhhhhheeeeeeejc`trshhhhhhhhhhhheeeeeeepcuinnkknkknknnnkkknnknknknnknkkkknshhhhhhhhhhhhhhod`uxnnkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkknknkknkknkibqhhhhoednnixu`amhhhhhhhhhhhhhoeejd`uinnxxnkknknkkkknknknkrvhhhhhhhhhhhhhheeeeeeejcwxnnkkkkkknkknntwcdc`tibqhhcnkkkkknnnkrqhhhhhhhhhhhheeeeeeejpctbhhhhhhhhhhhheeeeeeeepdgghhhhhhhhhhhheeeeeeejdaurfhhhhhhhhhhhoeeeeeeepawxnnbhhhhhhhhhhhoeeeeeejpauirvhhhhhhhhhhhheeeeeejdatinnikknkkkkknknkkkkkknknnkknknknnmhhhhhhhhhhhhhhlc`tinknkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkirvhhhhhedkniiuwcdshhhhhhhhhhhhhheeepauxinnknkkkkknnkknknknnrqhhhhhhhhhhhhhheeeeeejpauxnnnknknkkknnnxwcdawxrvhhoeikkknknknnbhhhhhhhhhhhhleeeeeeejdabshhhhhhhhhhhoeeeeeeejparmhhhhhhhhhhhheeeeeeejcwxrhhhhhhhhhhhhleeeeeejp`uinrshhhhhhhhhhhleeeeeejd`uirvhhhhhhhhhhhheeeeeejdwtiknnnkkkknnknknkkkkkkkkknnnnkkkknnvhhhhhhhhhhhhhljcwtinkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkknkkirvhhhhoejknnxuwcdp`fhhhhhhhhhhhhhleepcwtinnnnnknnkkkkkkknkknghhhhhhhhhhhhhhoeeeeeejd`tinknkkkkkkkknitwacaurshhhlpnknnnknknimhhhhhhhhhhhheeeeeeeepcwrfhhhhhhhhhhhleeeeeejjdwrfhhhhhhhhhhhleeeeeejpaurghhhhhhhhhhhheeeeeeejcwxinrqhhhhhhhhhhheeeeeeejdwtnrhhhhhhhhhhhhoeeeeeejcwxnknkknkkkknnnkkkkkkkknkknknnnnkknnifhhhhhhhhhhhhhedauinnkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkknkkknknkkkrrvhhhhheliknit`adpdcshhhhhhhhhhhhhoeejdwtinnknknknknknknknnnishhhhhhhhhhhhhhleeeeeejdwtnnkkknnkkknknnxw`a`rbqhhhlwnnknnknnnrvhhhhhhhhhhhheeeeeeejdatbhhhhhhhhhhhoeeeeeeljpatbhhhhhhhhhhhheeeeeeeedatishhhhhhhhhhhoeeeeeejpawiirmhhhhhhhhhhhheeeeeeepcwxnrhhhhhhhhhhhhoeeeeejpawxnknnnknkkkkkkkkkknkkkrsrkknknnknknnbqhhhhhhhhhhhhejd`tinkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkknnrvhhhhheennnixuadpdcabhhhhhhhhhhhhhheejdatinnnnknkknknknnnkknrfhhhhhhhhhhhhhheeeeeeepawinnkknknkknnnnnxtw`brfhhhoexknnninnnnrhhhhhhhhhhhhleeeeeeejcwrshhhhhhhhhhhoeeeeeelpcwbshhhhhhhhhhhheeeeedejdwtrmhhhhhhhhhhhoeeeeeejd`uiirqhhhhhhhhhhhoeeeeeejp`txnrhhhhhhhhhhhhoeeeeejd`tnikknkknnrnkkkknknkkknbhhmnkknnknkknishhhhhhhhhhhhljjcwxnnkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknrmhhhhhllnnnituacpdc`urhhhhhhhhhhhhhhleepcwxnkknnnnkknknkknnnnrhhhhhhhhhhhhhhoeeeeeejpatinkknnkkknkkknnnxtxrvhhhholnknnixxinishhhhhhhhhhhheeeeeeejpaurvhhhhhhhhhhheeeeeeljpaurvhhhhhhhhhhhleeeejrsaawxrvhhhhhhhhhhhleeeeeejc`tnrshhhhhhhhhhhhleeeeedddwtnnrhhhhhhhhhhhhoeeeeejdwxxnnkknnnrghgkkkkknnkkkshhhcnkknnnnknnimhhhhhhhhhhhoejpawinkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknnrshhhhhleunnixwacppc`uxrmhhhhhhhhhhhhhleejd`tinkknknknnnnknknnishhhhhhhhhhhhhhoeeeeeejd`xinkkkknkknnknnnnnrrvhhhhheannnxxtxinrmhhhhhhhhhhhoeeeeeeejc`xrhhhhhhhhhhhheeeeeeljc`trqhhhhhhhhhhheeeeebghhctirvhhhhhhhhhhhleeeeeepauxibqhhhhhhhhhhhheeeeelrsswinkrhhhhhhhhhhhhoeeeeejcwxnnkkknkrbqhhfkkknkkkknshhhenkkkknkkknirqhhhhhhhhhhoeejd`tnnkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkrshhhhhleunnituacpdd`wxnnshhhhhhhhhhhhhheejpauxnnnkkknknnnnkknkimhhhhhhhhhhhhhhleeeeeejcwxnnkknnnkknnknknnirvhhhhhhexnnxuwwuxirfhhhhhhhhhhhleeeeeejjawrshhhhhhhhhhhleeeeeelpawrbhhhhhhhhhhhheeeearqhhl`iivhhhhhhhhhhhleeeeejp`wrrmhhfhhhhhhhhhheeeeegbhhfikkiqhhhhhhhhhhhheeeeejcuxnknkkkirfhhhldkknkkkkimhhhlnnnnkknnnknishhhhhhhhhhoeejpauxnkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkknrshhhhhletnnixwaddpc`wxiknrhhhhhhhhhhhhhheeejcwxnnknknknnnnnnknnrfhhhhhhhhhhhhhheeeeeejpaunnnnnnknkkkknkkkrrvhhhhhhoennxtwaawxibhhhhhhhhhhhheeeeeeejdaurvhhhhhhhhhhheeeeeeejpaurshhhhhhhhhhhoeeejrmhhoeunivhhhhhhhhhhhleeeeejd`trshhmhhhhhhhhhhoeeee`rqhhlcnnnvhhhhhhhhhhhheeeeepawxknnkkirvhhhoe`kkknkkkrvhhhounknnnkknnnnrqhhhhhhhhhoeeejdwxnkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkknrshhhhhoeannixw`cppdauxinkkifhhhhhhhhhhhhhoeejd`txnnnnkknknknknknbhhhhhhhhhhhhhhoeeeeeeedaunnnkknkkkwcxnnirbqhhhhhhhldnitwacawtrghhhhhhhhhhhheeeeeeejcwxrhhhhhhhhhhhheeeeeeejcwtrmhhhhhhhhhhhleeegghhhedinivhhhhhhhhhhhleeeeejcwrbqhhshhhhhhhhhhleeecrvhhoe`kknmhhhhhhhhhhhhoeeejpauinkkknrshhhhepnnkknnnkrfhhhhdniiiinnnknnnshhhhhhhhhleeejpatikkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkknkkkkkkkkkkkkkkkkkkinrshhhhhhejknixu`cpdcawtinknknfhhhhhhhhhhhhhheejpauxnnkknnknknnnknimhhhhhhhhhhhhhhleeeeeejd`tinknnknknkntnrrshhhhhhhhheuitucpdauxrfhhhhhhhhhhhleeeeeejpaurghhhhhhhhhhhoeeeeeelpcwxrvhhhhhhhhhhheeebbqhhleunnnmhhhhhhhhhhhheeeeeparbqhhvmhhhhhhhhhhleepbshhhepnnkkghhhhhhhhhhhhheeeepauxnkkirshhhhlenknnnknnnrhhhhhjixttxinknknnghhhhhhhhheeeeepawxnkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkknkkkkknnnkknrrghhhhhhoeitxxu`ddpdawwuxkkktrshhhhhhhhhhhhhhoeepcwxinkkntxuntinknrfhhhhhhhhhhhhhhleeeeeepcwxnnittnknnnnrrgfhhhhhhhhhoewwuapjjdairhhhhhhhhhhhhleeeeeejd`trmhhhhhhhhhhhleeeeeejdauxrfhhhhhhhhhhheebbqhhoeaxnnkshhhhhhhhhhhhqeeej`rbqhhorvhhhhhhhhhhleprshhhletnknkiqhhhhhhhhhhhhqeejp`tinnirvhhhhleukkniniiinrhhhhhhutuuuxinnnknrhhhhhhhhheeeeejcwxnkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkknnnxkkktnixikirvhhhhhhhopawtu`cppdcwuwuwxnktxshhhhhhhhhhhhhhhjejd`tinnkn`uw`t`nkrghhhhhhhhhhhhhhhleeeeejpcuxikutuwnknirgfhhhhhhhhhhhlj`p`djjpcwrghhhhhhhhhhhheeeeeeejcwxrqhhhhhhhhhhheeeeeeejdwtirhhhhhhhhhhhhvrbqhhoejtnnnirhhhhhhhhhhhhhvmwrrmqhhoerhhhhhhhhhhhfsrshhhleannnnnimhhhhhhhhhhhhhfcppatiirbfhhhhoewnnnixtutxighhhhhhjw`awtnnnnnnrhhhhhhhhleeeeejd`tikkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkknnkkkkininitrbvhhhhhhhhhdxwuwcppdcwtx`cutnnnrshhhhhhhhhhhhhhhqplddpcccwkxtkuntnirfhhhhhhhhhhhhhhhleeeeeejjdtnkwawtirrsfhhhhhhhhhhhhhed`adpjjcwxrmhhhhhhhhhhhoeeeeeejpauighhhhhhhhhhhoeeeeeejpcuxirhhhhhhhhhhhhhvhhhhleaxiknxtvhhhhhhhhhhhhhhvvhhhhheprhhhhhhhhhhhhvfhhhoepxiknnxxxqhhhhhhhhhhhhhqsgrrbsfhhhhhoednnkixww`uxrshhhhhhqaacauinnknighhhhhhhoeeeeeejd`xinkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkknnkkxnnirrgqhhhhhhhhhhmt``cdppc`uxwikntknirfhhhhhhhhhhhhhhhhqscawxnkkkxtktnxrrvhhhhhhhhhhhhhhhhqcpeeejc`xiitrrrbsvhhhhhhhhhhhhhhhoewcjjjjjawxrfhhhhhhhhhhhleeeeeejc`trmhhhhhhhhhhhleeeeeejdatinrhhhhhhhhhhhhhhhhhledwxinxtwshhhhhhhhhhhhhhhhhhhhelirhhhhhhhhhhhhhhhhoejuxinixtuushhhhhhhhhhhhhhhhhhhhhhhhhoecnknitu`aawtrshhhhhhhqddcwxnknnrfhhhhhhhleeeeeejd`tnnkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkknkkxrrgvhhhhhhhhhhhhhfgbuppc`uxiunirrrbsfhhhhhhhhhhhhhhhhhhhfsbrinknxxirrbsqhhhhhhhhhhhhhhhhhhqmsrrrrrrgsgmvqhhhhhhhhhhhhhhhhhhoe`djejejatxbhhhhhhhhhhhheeeeeeejcwtrfhhhhhhhhhhheeeeeeejcwxnnifhhhhhhhhhhhhhhhlejauxiiuw`wqhhhhhhhhhhhhhhhhhhlexkifhhhhhhhhhhhhhhheeauxxixww`wumhhhhhhhhhhhhhhhhhhhhhhhoedkkiixu`cca`trvhhhhhhhhmcd`tnnnrshhhhhhhleeeeeeejd`xnkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkknkkkkniinkkkngqhhhhhhhhhhhhhhhhhhqhpauxnktarvqhhhhhhhhhhhhhhhhhhhhhhhhhhhfskiaurvhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhejejeejjdddgshhhhhhhhhhhoeeeeeejpaurbhhhhhhhhhhhoeeeeeeepcuinknmhhhhhhhhhhhhhhleed`uxitu`awgqhhhhhhhhhhhhhhhhlewnnkmhhhhhhhhhhhhhheep`txxxuwa`wtimhhhhhhhhhhhhhhhhhhhhhlednnkxxu`cccauxrvhhhhhhhhhfgubrrbmhhhhhhhlejjeeeeejdwtnkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkknghhhhhhhhhhhhhhhhhhhhhj`tinkkkrhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhowkkkrhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhejjeeejjcuxrvhhhhhhhhhhhleeeeeejd`tishhhhhhhhhhhleeeeeejd`uxnnknhhhhhhhhhhhhhleejd`uttw`aawxshhhhhhhhhhhhhhheeaxnniiqhhhhhhhhhhhoeeedautttwaawuxinahhhhhhhhhhhhhhhhhhoeeunnnixuwaccawtirqhhhhhhhhhhhhvvfhhhhhhhhlepdjeeeeepcuxnnkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkrhhhhhhhhhhhhhhhhhhhhhewxnkkkkkhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhodnkkkhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhoejjeeejpauxnhhhhhhhhhhhheeeeeeejcwxivhhhhhhhhhhheeeeeeejd`tnnknkrhhhhhhhhhhleeeejdawuw`aawuxiwhhhhhhhhhhhhoeecwttxtuwhhhhhhhhhhleeejpawuw`aa`wtnnnn`ohhhhhhhhhhhhhholejxnnnxtu`cddawuxnrhhhhlllohhhhhhhhhhhhhhlee`wcjeeeejdauinkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkteeeeeeeeeeeeeeeeeeeeewxnnkkknkeeeeeeeeeeeeeeeeeeeeeeeeeeeeeepnnnkkeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeejd`tinneeeeeeeeeeeeeeeeeepauxnkdeeeeeeeeeeeeeeeeepcuxnnknknnoohhhooleeeeeeepcaaaaa`uxnnnxoohhhhhholeeejda`www`adohhhhhhoeeeeeepdaa`acawtxnnnnitplohhhhhhhhoolee`tttttu``ccdc`txinihhhel``dllohhhhhhhholeeaixwdjeeeejcwxikkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkknnnixuwadpeeeeejdwtinnnkkkkkknknnniixwapeeeeeeeeeeeeepc`txinnnnknknnkniiuwcpleeeeeeeeeeelpawxinnnnnnnnixxxxuuw`adpjjeeeeeeepcwtnknknnnniuadleeeeeeejp`tinkkknknixwdjeeeeeeejd`uinnkkknkn`peeeeeeeeeeeejpddccawtiiknniclllleeeeeeeejpccccccccpllleeeeeeeeejpdccca`uiiknknnxwajeelllleeeeepc`wwww`acddda`utnnnnglejxnxwdjeeelllleeed`knit`djeejjdauxnnkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkknknnixuwadjjeeeeejdawtxinnnkknkknnnixtu`cpleeeeeeeeeeeejpc`uuxiinnnknnnixuwapjeeeeeeeeeeeeejc`utxiniixxxxtuuw`acdppjeeeeeeeejpatxikknkkkniuapjeeeeeeejdwtnnkkkkknit`djeeeeeeejd`tnnknnknknniuapeeeeeeeeejjjdcawtinnknnixwcleeeeeeeeeejjpppdcawuucpjeeeeeeeeejjpdc`uxinkkkknitwcpjeeeeeeeeejppdcccddppdc`uxinkkkiuuxnit`djeeljjdc`iinnnnxwcpjeejpawxnnkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkknitw`cpjjeeeeeejjda`wtxnnkkknknixtuw`cpjeeeeeeeeeeeeeejpca`wutinnknnitw`cdjjeeeeeeeeeeeeejpcawwuuuuuwww``acddpjjjeeeeeeeeejd`tinnknkknnxucpeeeeeeejpcwinnkkknkiiuadjeeeeeejjawxnnkkknknknitadjeeeeeeeeejpdcwtinnknkkniu`djeeeeeeeeeeljjpdawttxuadjeeeeeeeejjpc`utinnknkkknitwcpjeeeeeeeeeejjjjjpjpdc`tixnknnnknkkkxtadjjeejpd`wuxxxxxw`djjjjpcwtinkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkknkixuacdjjjejeejejjddaawtinnkkknnxtw`acdpjejeeeeeeeejejjjjpdaa`utinnnitwacdpjjeeeeeeeeeejejjjddcaa`a`aaacccddppjjejejeeeeejjpcwxnknkknnknxwcpjeeeejejd`tinkkkkknnxuapjjeeeejjdauinknkknkkknixwcpeeeeeeeejjpa`txnknknknnnxwadjleeeeeeeejjpdawtiiitwcpeeeeeeeejpcauxinknknknknnxtwcdjjeeeeeeeeejjjjjpcawuxikikknknknnnitapjjjjjppcawuuuuwacpjjjda`txnnknkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkknntw`cdpppjjpjpjppddca`uxnnkkknixu`acddpppjppjpppjpjjjpppddcaawtxnnnxu`acdpppppppppjppjjpjppddccaccacccccddddppppppjppppjpdc`txnkkknkknnxwacpppppppdcwxinkkkknknxuacpppppppdawxinknnkknkknnxuacpjejejjjpcautinknkkknknnxxwadpjeeeejejjpd`wxinnniu`cpjeeeejjpc`utnnknkkkkkknnnxtwacppejeejejeejjpdcawuinnkkknknknkknxu`dppppddddcca```ccdpppcawxxnkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkknnxu`aaaccacccacacaaa`wtinkknkknitw`aaaacaacccccacccaccacaca``wtinnnitw`aaaaacacacaccccccacaaaa````a`aaaaaaaacccacaccdcacaawuxnnkknkknknxuwaaccccaa`wuinknkkkknnitwaaccccacawtinknknknnkknnnxu`cdpppddcawuxinnkkkkkkknnnitw`ddppjjppdda`uxikkknnxu`ddppppdcawuxnnknknnkknkknnnitu`acdppjjjjpppdc`wuxinnknkknkkkkknnit`cccaaaaaccccccacdcccawuxinkkkkkknkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkknixtuuuuuwuuuwuuuuuuttxixkkkknnixttuuuuuwuuuuwuwuuuwuwuwuuuuttxnnnnxattuuuwuuuuudauuutuuwu`uuuuuuwuuuac`cuwuawuuuwuwawwuutxxnnnkkkkknnnnxcwuuuuuuuttinnkkkkkkknnactuuuuu`ctxxii`iwikknkkknnixuw`aaa``wutxinkkkkkkkutkkknixuwaaccccaawutxnw`ikkkixu`acdccawuxinnnkkkkknknki`kknnxxuwaadccccca``wuxinnnkkkkkkknnknkkitu``wuuuuww```aaaaaa`wutxiknkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkknnixxxxxxxxiiiiiiixinnwnkkkkknnnniiiiiixixixxixixiixxxxxxxxiinnknnntiiixxxixxxxpxxixxiii`txxxxiuwixiucupixiiwixixixwiixxiinkkkkkkkkkknnniuxxiiiiuiinnkkkkkknkknntiixiiuxiatnnkdndxkknknkknnnxxtuuuuxxxinnnkknkkkkkxknkkknuxuuwwwwuuxxinnknxkkknnixuuwwuutxnnkkkkkknknkkkkxnknknnittuwawwwuuutxinnnkkkkkkkkkkkkkknnixuttxiixxttuuwwwuuuttxinnkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkknnknnnnnkninnnknnnnnkwkknknxinkntnxxinnxxnxtknnnnttnnnxxxtiknkkixnxnnnnnnnnnnuunnnnknnnwnnnnnnunnnnt`icnnnnunnknknitnnnknkknkkkiinxxknnnxxtnnniwxxxnkxixninnkkkxnnknkxnnnnknkck`nknkkknkknknnniiiiinnnkknkkknkkkkinxnkniwtuwtxututitnnkkkxnkkkknnixiutuxixknkkixnkkknxxnxkknnxxnniix`xxxxiinnnnkkkkkkkkkkkknkkkkkniininnnnnniixxxxxxiinnknkknkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkknkknknkknkknknkkkkkkkkiikkkkxxxtkkxwuxttknu`xx`kkxuxxwnkiwtxtiknxtxuwkkkkknkkknunkkkknkkiiknnnnntknkknukukkkkktkkkkkntkkkkkkkkkkkiuwxxwkkk`xxukknuxxnkkxwxwxtiknkxkkkkkiwinkkkk`kukknkkkkkkkknknnnnnknknkkkkkkkknkkutxtnknutttnntwtwxxtkkkkikkkkkknnnnx`xwxxxkkutxuxnkitxuwkkxuxiwnnnnxxnnnnnnnkkkkkkkkkkkkkkknkknknnnnknkkknknnnnnnnnnnnknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkxkkkkktwutkkktkkktkktkkknxnuixxtukkikkkxkkxkkktnnknkkknkkkkknkknkkxkkkkkkkxkkkkkkkknknkktnkkkkkntkkkkkkkkkkktkkknxnkxkkxkkkxkkkkkkukxkkxkkkxkkkkkkkktikkkknkkkkknknkkkkknkkkkknkknknknknkkkkkikkkxkkxkknnnk`ktkkxkknkxkknkwuwwwikwkxkkiknnkkkxkktkkktkkuiixtukkkkxkkkkkkkkkkkkkkkknkknkkkknkkkknknkkkkknknkkknknknkkknknkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkknkkkkkkkkkxkkkkxnkkxkkktkkkxnktkkknikwiixiinkxkkkxkkxkkkikkkkknkkkkkkkkkkkknikkknknkxknkkknkknkknknukkkkkkwkkkkkkkknkktkkknikkxkkxkkkxknkkkkwkikkxkkkxkkkkkikknxkkkkkkkknkkknknkkkkkkkkkkkkkkkkkkkkkkkkxkknxkkxknkkknwkxkkxnkknxkkkkkkkkknkwkikkikxkkkkxkkxkkkxknuxiixnkkkkxkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkknknkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkknkknikkkxkknukkkwnknxkkutknukkttkkknkkxnnkxkktnkiwkknkkkkkkkkkkkkkkkknxkkknkntkkkkkknkkkknkktkkkkkknnkkkkiukkkkttkntkkkxkkikkktkkknkkukxkkxkkkxkkkkkttxxkkkknknkkknkkkkknknkkkkkkknwiknkknkkkkkkxkkkxkkinknnkkwkikkinkkkxnknkkkkkkkkukikkikktnknxkktnkiwkktxkkknknktkkkkkkknknkkkkkkkkkkkkkknknkkkkkkkknkknkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkktkkknuuixtkkituxkkkinutnkkkiuwiknxuikxukkktuxnwkkknknknkkkknkkkkkkukknkkktnkkkkkknkkkkkkntkkkkkkukkkkiukkkkinutnkkuuknuukkkuwuikuukxnkukxuuwuikkkkiknkkknkkkkkknkknkkkkkkkkkkknunkknkkkkkknxunkuuikkxwuxktuinxkxinwuuutkkkkkkkktuinxkxnkkuuxkkkkuuxnukknuuiknkkukkkkkkkkkkkkkkkkkkkknkkknkkkkknknkkkkkkkkkkkkkkkkkknknkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkknkkkkknnkkkkkkkkkkikkkkkkikkkkknkkkknkkkkkknkkkkkkkknkkkkkkkkkkkkknkkkkkniknknkkxkkkkkkkknknkkknnkkkkkikkkkkkkkkkxkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkknknkkknkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkknkkknkkkkkkkkkkkkkkknknkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkxnkkkkkkkkkkknkkkkkkkkkkkkkknknkknkkkkknkkkkkkkknknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkuwtkkkkxwuknkkknkkkkknkkkkkkkkkkkkkkknkkknkknkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkxwunkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkknknkknkkkkkkkknkkkkkkkknkkkkkkkkkkkknknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkknkkkkkkkkkkkkkkkknkkknkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknknkkkkkkkkkknknkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkknkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkknknkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkknkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkknkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkknkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkknknknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkknkknkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknkkkkkkkkkkkkknkkknknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkknknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkknkknkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkknkkkknkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkknkknkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkknkkkkknkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkknnkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkknkkkknkkkkkkkkkkkkkkknknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkknkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkknknknktixikkkxkkkkkkinkkkkkkkkkkkkkkkkkkknxkkkkkkkkkkkkkkkkkkkkknxnkkkkkkikkkkkixnxkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkktikkkkkkkkkkkkkkkkkkkkktxkkkkknkkkkkkkkkkkkkkkkkkkkkkkkinkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkknkkkkkkkkkkkkkkkkkkxnkkkxixtkkkknkkkkkkikkkkkkkkkkkkkkkkkkkknkkkkkkknkkkkkkkkkkkkkkknkkkkkikkukkkntnukkkkkkkkkkkkkkkkkkkkkkknkkkknkkkknkkkkkknkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkknkkkkkkkikkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkikkkkxnixkkkkikkkkkkiknkkkkkkkkkkkknnnkkknknkkkkninnkkknnnknkkkkknkkkkknkkkkkknxktkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkinikkkninnnkkininnnkkkknkkkkkkkkkkkiniknnkkkknikkkkknnknkkkknkkkkkkikkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkknnkkknnnnnkkkkknkkkkkkikkkkkkkkkkknxnninkkninnnkkninnkkkinninikkkknkkkkkninkkkkkikikkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkxnnikkninnnkknxnxninkkknkkkkkkkkkkknxnxnnnkkxnnxnkkinnxnkkinniikkkknkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkikkkkkkikkkkkkkkkkknnnnnxkknkkknkkknkkkkknnknknkkkknkkkkkkkkikkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknkkknkkkkkkxknkknkkknkkkkkxxxxxkkxknkknknkkkknknkkkknkkinnnikkkknkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkknkkkkkkkikkkkkkkkkkinnnnnkkkkkknkkknkkkkknnknknkkkknkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknkkknkkkkkkiknkknkkknkkkkkkkkkkkkiknkknknkkkknknkkkknkkinnnnkkkknkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkknkkkkkknkkkkkiikkkkikkkkkknkkknkkknkkkkknkkkkkkkkknkkkknninkkkkkkkkkkkkkkkkkkkkkkkkkkkkikkkkkkkkkkkknkknkkknkkkkkkiknkknkkknkkkkkkkkkkkkiknkknknnkknkkknkknnkkxkkkkkkkknkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkknkkkkkkknkkkknnkkkkkiinkkknnknnnkkkinnkkinkikknkninnikkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkknikkkkkkkkkkkiikkiikkkninkkiiknnkiknninikkkkkkkkkinknkkikkkiinkkkkinnnnkkniikkkkknkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk"
 };
 
 Some packages are fairly large; those have been given their own	directories:
 
+	auctex		A package for editing TeX documents.
+
 	bytecomp	The XEmacs-lisp compiler.
 
 	calendar	A calendar and appointment manager.
 
+	cl		Common Lisp compatibility code.
+
 	comint		General code for interacting with inferior processes,
 			like shell buffers and lisp interpreters.
 
-	dired		The directory editor.
+	custom		User environment customization code.
 
 	edebug		A source-level debugger for Elisp.
 
 	ediff		A comprehensive visual interface to diff and patch.
 
+	efs		The directory editor, remote FTP frontend.
+
 	electric	The "electric" commands; these implement temporary
 			windows for help, list-buffers, etc.
 
 	eterm		A merge of the comint shell mode with an
 			ANSI-compatible terminal-emulator.
 
-	gnus		An NNTP-based newsreader; version 3.14.
+	gnus		A network news and mail reader.
 
 	hm--html-menus	Menu interface to html-mode.
 
 	ilisp		A comint-based package for interacting with inferior
 			lisp processes.
 
+	iso		ISO Latin language support.
+
+	mailcrypt	Package for dealing with PGP encrypted messages.
+
+	mel		MIME encoding library (part of the Tools for MIME).
+
 	mh-e		An interface to the MH-E mail handling system.
 
+	mu		Message Utilities library (part of the Tools for
+			MIME).
+
+	ns		NeXTStep support.
+
 	oobr		An Object-Oriented class browser.
 
 	pcl-cvs		An interface to the Concurrent Version System.
 
+	psgml		General purpose SGML editing support with extra
+			support for editing HTML.
+
 	rmail		A BABYL-format mail reader.
 
 	sunpro		Additional code for interfacing with SunPro products.
 
+	tl		Tiny Library (Part of the Tools for MIME).
+
+	tm		Tools for MIME.  MIME support for emacs lisp based
+			news and mail readers.
+
 	tooltalk	An inteface to the ToolTalk communication protocol.
 
 	viper		A full-featured VI emulator.

lisp/custom/ChangeLog

+Mon Mar 24 18:36:15 1997  Per Abrahamsen  <abraham@dina.kvl.dk>
+
+	* Version 1.67 released.
+
+Mon Mar 24 18:19:05 1997  Per Abrahamsen  <abraham@dina.kvl.dk>
+
+	* cus-edit.el (custom-save-all): Added autoload.
+
+	* Version 1.66 released.
+
+Mon Mar 24 18:09:04 1997  Per Abrahamsen  <abraham@dina.kvl.dk>
+
+	* wid-edit.el (widget-default-delete): Added workaround for bug
+	with empty `:format'.
+
+Thu Mar 20 12:33:59 1997  Per Abrahamsen  <abraham@dina.kvl.dk>
+
+	* custom.texi (The Init File): Explain that `custom-file' is not
+	automatically loaded.
+
 Tue Mar 18 14:42:31 1997  Per Abrahamsen  <abraham@dina.kvl.dk>
 
 	* Version 1.65 released.

lisp/custom/cus-edit.el

 ;;
 ;; Author: Per Abrahamsen <abraham@dina.kvl.dk>
 ;; Keywords: help, faces
-;; Version: 1.65
+;; Version: 1.67
 ;; X-URL: http://www.dina.kvl.dk/~abraham/custom/
 
 ;;; Commentary:
   (custom-mode)
   (widget-insert "This is a customization buffer.
 Push RET or click mouse-2 on the word ")
+  ;; (put-text-property 1 2 'start-open nil)
   (widget-create 'info-link 
 		 :tag "help"
 		 :help-echo "Read the online help."
       (unless (eolp)
 	(princ "\n")))))
 
+;;;###autoload
 (defun custom-save-all ()
   "Save all customizations in `custom-file'."
   (custom-save-variables)

lisp/custom/cus-face.el

 ;;
 ;; Author: Per Abrahamsen <abraham@dina.kvl.dk>
 ;; Keywords: help, faces
-;; Version: 1.65
+;; Version: 1.67
 ;; X-URL: http://www.dina.kvl.dk/~abraham/custom/
 
 ;;; Commentary:

lisp/custom/custom.el

 ;;
 ;; Author: Per Abrahamsen <abraham@dina.kvl.dk>
 ;; Keywords: help, faces
-;; Version: 1.65
+;; Version: 1.67
 ;; X-URL: http://www.dina.kvl.dk/~abraham/custom/
 
 ;;; Commentary:

lisp/custom/wid-browse.el

 ;;
 ;; Author: Per Abrahamsen <abraham@dina.kvl.dk>
 ;; Keywords: extensions
-;; Version: 1.65
+;; Version: 1.67
 ;; X-URL: http://www.dina.kvl.dk/~abraham/custom/
 
 ;;; Commentary:

lisp/custom/wid-edit.el

 ;;
 ;; Author: Per Abrahamsen <abraham@dina.kvl.dk>
 ;; Keywords: extensions
-;; Version: 1.65
+;; Version: 1.67
 ;; X-URL: http://www.dina.kvl.dk/~abraham/custom/
 
 ;;; Commentary:
 	(inhibit-read-only t)
 	after-change-functions)
     (widget-apply widget :value-delete)
-    (delete-region from to)
+    (when (< from to)
+      ;; Kludge: this doesn't need to be true for empty formats.
+      (delete-region from to))
     (set-marker from nil)
     (set-marker to nil)))
 
 	    (setq children (cdr children)))
 	  (setcdr children (cons child (cdr children)))))))
   (widget-setup)
-  (widget-apply widget :notify widget))
+ widget (widget-apply widget :notify widget))
 
 (defun widget-editable-list-delete-at (widget child)
   ;; Delete child from list of children.

lisp/custom/widget-example.el

 ;;
 ;; Author: Per Abrahamsen <abraham@dina.kvl.dk>
 ;; Keywords: help, extensions, faces, hypermedia
-;; Version: 1.65
+;; Version: 1.67
 ;; X-URL: http://www.dina.kvl.dk/~abraham/custom/
 
 (require 'widget)

lisp/custom/widget.el

 ;;
 ;; Author: Per Abrahamsen <abraham@dina.kvl.dk>
 ;; Keywords: help, extensions, faces, hypermedia
-;; Version: 1.65
+;; Version: 1.67
 ;; X-URL: http://www.dina.kvl.dk/~abraham/custom/
 
 ;;; Commentary:

lisp/efs/efs-cu.el

 		       (user-login-name))))
 	(efs-set-user host user)))))
 
+;;;###autoload
 (defun efs-ftp-path (path)
   "Parse PATH according to efs-path-regexp.
 Returns a list (HOST USER PATH), or nil if PATH does not match the format."
 
 ;;; Getting directory listings.
 
-(defun efs-directory-files (directory &optional full match nosort)
+(defun efs-directory-files (directory &optional full match nosort &rest ignored-for-now)
   ;; Returns directory-files for remote directories.
   ;; NOSORT is a V19 arg.
   (let* ((directory (expand-file-name directory))

lisp/gnus/ChangeLog

+Mon Mar 24 16:57:26 1997  Lars Magne Ingebrigtsen  <larsi@menja.ifi.uio.no>
+
+	* gnus.el: Gnus v5.4.37 is released.
+
+Mon Mar 24 01:16:15 1997  Hrvoje Niksic  <hniksic@srce.hr>
+
+	* gnus-xmas.el (gnus-xmas-redefine): Use it.
+
+	* gnus-xmas.el (gnus-xmas-summary-set-display-table): New function.
+
+	* gnus-sum.el (gnus-summary-mode): Use it.
+
+	* gnus-sum.el (gnus-summary-set-display-table): New function.
+
+Mon Mar 24 16:27:46 1997  Lars Magne Ingebrigtsen  <larsi@ifi.uio.no>
+
+	* gnus-util.el (gnus-buffer-live-p): Reinstated.
+
 Mon Mar 24 01:24:27 1997  Lars Magne Ingebrigtsen  <larsi@menja.ifi.uio.no>
 
 	* gnus.el: Gnus v5.4.36 is released.

lisp/gnus/gnus-async.el

 
 (defun gnus-async-prefetch-next (group article summary)
   "Possibly prefetch several articles starting with the article after ARTICLE."
-  (when (and (buffer-live-p summary)
+  (when (and (gnus-buffer-live-p summary)
 	     gnus-asynchronous
 	     (gnus-group-asynchronous-p group))
     (save-excursion
 
 (defun gnus-async-prefetch-article (group article summary &optional next)
   "Possibly prefetch several articles starting with ARTICLE."
-  (if (not (buffer-live-p summary))
+  (if (not (gnus-buffer-live-p summary))
       (gnus-async-with-semaphore
        (setq gnus-async-fetch-list nil))
     (when (and gnus-asynchronous
       (let ((do-fetch next)
 	    (do-message t)) ;(eq major-mode 'gnus-summary-mode)))
 	(when (and (gnus-group-asynchronous-p group)
-		   (buffer-live-p summary)
+		   (gnus-buffer-live-p summary)
 		   (or (not next)
 		       gnus-async-fetch-list))
 	  (gnus-async-with-semaphore
 		      ,mark (set-marker (make-marker) (point-max))
 		      ,group ,article)
 		gnus-async-article-alist)))
-       (if (not (buffer-live-p ,summary))
+       (if (not (gnus-buffer-live-p ,summary))
 	   (gnus-async-with-semaphore
 	    (setq gnus-async-fetch-list nil))
 	 (gnus-async-prefetch-article ,group ,next ,summary t)))))

lisp/gnus/gnus-salt.el

 
 (defun gnus-pick-setup-message ()
   "Make Message do the right thing on exit."
-  (when (and (buffer-live-p gnus-summary-buffer)
+  (when (and (gnus-buffer-live-p gnus-summary-buffer)
 	     (save-excursion
 	       (set-buffer gnus-summary-buffer)
 	       gnus-pick-mode))

lisp/gnus/gnus-score.el

   "Add SCORE to all followups to the article in the current buffer."
   (interactive "P")
   (setq score (gnus-score-default score))
-  (when (buffer-live-p gnus-summary-buffer)
+  (when (gnus-buffer-live-p gnus-summary-buffer)
     (save-excursion
       (save-restriction
 	(message-narrow-to-headers)
   "Add SCORE to all later articles in the thread the current buffer is part of."
   (interactive "P")
   (setq score (gnus-score-default score))
-  (when (buffer-live-p gnus-summary-buffer)
+  (when (gnus-buffer-live-p gnus-summary-buffer)
     (save-excursion
       (save-restriction
 	(goto-char (point-min))

lisp/gnus/gnus-sum.el

 
 (defvar gnus-scores-exclude-files nil)
 
-(defvar gnus-summary-display-table
-  ;; Change the display table.	Odd characters have a tendency to mess
-  ;; up nicely formatted displays - we make all possible glyphs
-  ;; display only a single character.
-
-  ;; We start from the standard display table, if any.
-  (let ((table (or (copy-sequence standard-display-table)
-		   (make-display-table)))
-	;; Nix out all the control chars...
-	(i 32))
-    (while (>= (setq i (1- i)) 0)
-      (aset table i [??]))
-    ;; ... but not newline and cr, of course.  (cr is necessary for the
-    ;; selective display).
-    (aset table ?\n nil)
-    (aset table ?\r nil)
-    ;; We nix out any glyphs over 126 that are not set already.
-    (let ((i 256))
-      (while (>= (setq i (1- i)) 127)
-	;; Only modify if the entry is nil.
-	(or (aref table i)
-	    (aset table i [??]))))
-    table)
-  "Display table used in summary mode buffers.")
-
 (defvar gnus-original-article nil)
 (defvar gnus-article-internal-prepare-hook nil)
 (defvar gnus-newsgroup-process-stack nil)
   (setq truncate-lines t)
   (setq selective-display t)
   (setq selective-display-ellipses t)	;Display `...'
-  (setq buffer-display-table gnus-summary-display-table)
+  (gnus-summary-set-display-table)
   (gnus-set-default-directory)
   (setq gnus-newsgroup-name group)
   (make-local-variable 'gnus-summary-line-format)
   (mouse-set-point e)
   (gnus-summary-next-page nil t))
 
+(defun gnus-summary-set-display-table ()
+  ;; Change the display table.  Odd characters have a tendency to mess
+  ;; up nicely formatted displays - we make all possible glyphs
+  ;; display only a single character.
+
+  ;; We start from the standard display table, if any.
+  (let ((table (or (copy-sequence standard-display-table)
+		   (make-display-table)))
+	;; Nix out all the control chars...
+	(i 32))
+    (while (>= (setq i (1- i)) 0)
+      (aset table i [??]))
+    ;; ... but not newline and cr, of course.  (cr is necessary for the
+    ;; selective display).
+    (aset table ?\n nil)
+    (aset table ?\r nil)
+    ;; We nix out any glyphs over 126 that are not set already.
+    (let ((i 256))
+      (while (>= (setq i (1- i)) 127)
+	;; Only modify if the entry is nil.
+	(or (aref table i)
+	    (aset table i [??]))))
+    (setq buffer-display-table table)))
+
 (defun gnus-summary-setup-buffer (group)
   "Initialize summary buffer."
   (let ((buffer (concat "*Summary " group "*")))
 	(setq gnus-reffed-article-number reffed)
 	(setq gnus-current-score-file score-file)
 	;; The article buffer also has local variables.
-	(when (buffer-live-p gnus-article-buffer)
+	(when (gnus-buffer-live-p gnus-article-buffer)
 	  (set-buffer gnus-article-buffer)
 	  (setq gnus-summary-buffer summary))))))
 
              ;; The `gnus-summary-buffer' variable may point
              ;; to the old summary buffer when using a single
              ;; article buffer.
-             (unless (buffer-live-p gnus-summary-buffer)
+             (unless (gnus-buffer-live-p gnus-summary-buffer)
                (set-buffer gnus-group-buffer))
              (set-buffer gnus-summary-buffer)
              (gnus-set-global-variables))))

lisp/gnus/gnus-util.el

     (let ((ids (inline (gnus-split-references references))))
       (car (last ids (or n 1))))))
 
+(defsubst gnus-buffer-live-p (buffer)
+  "Say whether BUFFER is alive or not."
+  (and buffer
+       (get-buffer buffer)
+       (buffer-name (get-buffer buffer))))
+
 (defun gnus-horizontal-recenter ()
   "Recenter the current buffer horizontally."
   (if (< (current-column) (/ (window-width) 2))

lisp/gnus/gnus-xmas.el

 	  (gnus-horizontal-recenter)
 	  (select-window selected))))))
 
+(defun gnus-xmas-summary-set-display-table ()
+  ;; Setup the display table -- like gnus-summary-setup-display-table,
+  ;; but done in an XEmacsish way.
+  (let ((table (make-display-table))
+	;; Nix out all the control chars...
+	(i 32))
+    (while (>= (setq i (1- i)) 0)
+      (aset table i [??]))
+    ;; ... but not newline and cr, of course.  (cr is necessary for the
+    ;; selective display).
+    (aset table ?\n nil)
+    (aset table ?\r nil)
+    ;; We nix out any glyphs over 126 that are not set already.
+    (let ((i 256))
+      (while (>= (setq i (1- i)) 127)
+	;; Only modify if the entry is nil.
+	(or (aref table i)
+	    (aset table i [??]))))
+    (add-spec-to-specifier current-display-table table (current-buffer) nil)))
+
 (defun gnus-xmas-add-hook (hook function &optional append local)
   (add-hook hook function))
 
 
 (defun gnus-xmas-redefine ()
   "Redefine lots of Gnus functions for XEmacs."
-  (fset 'gnus-summary-make-display-table 'ignore)
+  (fset 'gnus-summary-set-display-table 'gnus-xmas-summary-set-display-table)
   (fset 'gnus-visual-turn-off-edit-menu 'identity)
   (fset 'gnus-summary-recenter 'gnus-xmas-summary-recenter)
   (fset 'gnus-extent-start-open 'gnus-xmas-extent-start-open)

lisp/gnus/gnus.el

   :link '(custom-manual "(gnus)Exiting Gnus")
   :group 'gnus)
 
-(defconst gnus-version-number "5.4.36"
+(defconst gnus-version-number "5.4.37"
   "Version number for this version of Gnus.")
 
 (defconst gnus-version (format "Gnus v%s" gnus-version-number)

lisp/gnus/nnfolder.el

        (let ((bufs nnfolder-buffer-alist))
 	 (save-excursion
 	   (while bufs
-	     (if (not (buffer-live-p (nth 1 (car bufs))))
+	     (if (not (gnus-buffer-live-p (nth 1 (car bufs))))
 		 (setq nnfolder-buffer-alist
 		       (delq (car bufs) nnfolder-buffer-alist))
 	       (set-buffer (nth 1 (car bufs)))
   (when (and server
 	     (not (nnfolder-server-opened server)))
     (nnfolder-open-server server))
-  (unless (buffer-live-p nnfolder-current-buffer)
+  (unless (gnus-buffer-live-p nnfolder-current-buffer)
     (setq nnfolder-current-buffer nil
 	  nnfolder-current-group nil))
   ;; Change group.
 	;; is live, verify that nobody else has touched the file since last
 	;; time.
 	(when (and nnfolder-current-buffer
-		   (not (buffer-live-p nnfolder-current-buffer)))
+		   (not (gnus-buffer-live-p nnfolder-current-buffer)))
 	  (setq nnfolder-buffer-alist (delq inf nnfolder-buffer-alist)
 		nnfolder-current-buffer nil))
 
 (defun nnfolder-possibly-change-folder (group)
   (let ((inf (assoc group nnfolder-buffer-alist)))
     (if (and inf
-	     (buffer-live-p (cadr inf)))
+	     (gnus-buffer-live-p (cadr inf)))
 	(set-buffer (cadr inf))
       (when inf
 	(setq nnfolder-buffer-alist (delq inf nnfolder-buffer-alist)))

lisp/gnus/nnheader.el

 (defun nnheader-init-server-buffer ()
   "Initialize the Gnus-backend communication buffer."
   (save-excursion
-    (unless (buffer-live-p nntp-server-buffer)
+    (unless (gnus-buffer-live-p nntp-server-buffer)
       (setq nntp-server-buffer (get-buffer-create " *nntpd*")))
     (set-buffer nntp-server-buffer)
     (buffer-disable-undo (current-buffer))

lisp/gnus/nnmail.el

 
 (defun nnmail-cache-insert (id)
   (when nnmail-treat-duplicates
-    (unless (buffer-live-p nnmail-cache-buffer)
+    (unless (gnus-buffer-live-p nnmail-cache-buffer)
       (nnmail-cache-open))
     (save-excursion
       (set-buffer nnmail-cache-buffer)

lisp/gnus/nntp.el

   "Say whether a connection to SERVER has been opened."
   (and (nnoo-current-server-p 'nntp server)
        nntp-server-buffer
-       (buffer-live-p nntp-server-buffer)
+       (gnus-buffer-live-p nntp-server-buffer)
        (nntp-find-connection nntp-server-buffer)))
 
 (deffoo nntp-open-server (server &optional defs connectionless)

lisp/gnus/nnweb.el

 
 (deffoo nnweb-close-group (group &optional server)
   (nnweb-possibly-change-server group server)
-  (when (buffer-live-p nnweb-buffer)
+  (when (gnus-buffer-live-p nnweb-buffer)
     (save-excursion
       (set-buffer nnweb-buffer)
       (set-buffer-modified-p nil)
 
 (deffoo nnweb-close-server (&optional server)
   (when (and (nnweb-server-opened server)
-	     (buffer-live-p nnweb-buffer))
+	     (gnus-buffer-live-p nnweb-buffer))
     (save-excursion
       (set-buffer nnweb-buffer)
       (set-buffer-modified-p nil)
 
 (defun nnweb-init (server)
   "Initialize buffers and such."
-  (unless (buffer-live-p nnweb-buffer)
+  (unless (gnus-buffer-live-p nnweb-buffer)
     (setq nnweb-buffer
 	  (save-excursion
 	    (nnheader-set-temp-buffer
       t)))
 
 (defun nnweb-callback (buffer callback)
-  (when (buffer-live-p url-working-buffer)
+  (when (gnus-buffer-live-p url-working-buffer)
     (save-excursion
       (set-buffer url-working-buffer)
       (funcall (nnweb-definition 'article))

lisp/modes/cc-mode.el

 ;;          1987 Dave Detlefs and Stewart Clamen
 ;;          1985 Richard M. Stallman
 ;; Created: a long, long, time ago. adapted from the original c-mode.el
-;; Version:         4.387
-;; Last Modified:   1997/03/21 20:25:33
+;; Version:         4.388
+;; Last Modified:   1997/03/25 03:19:17
 ;; Keywords: c languages oop
 
 ;; NOTE: Read the commentary below for the right way to submit bug reports!
 		(if (looking-at "typedef[^_]")
 		    (progn (forward-sexp 1)
 			   (c-forward-syntactic-ws indent-point)))
-		(setq placeholder (c-point 'bol))
+		(setq placeholder (c-point 'boi))
 		(and (or (looking-at "enum[ \t\n]+")
 			 (= char-before-ip ?=))
 		     (save-excursion
 
 ;; defuns for submitting bug reports
 
-(defconst c-version "4.387"
+(defconst c-version "4.388"
   "CC Mode version number.")
 (defconst c-mode-help-address
   "bug-gnu-emacs@prep.ai.mit.edu, cc-mode-help@python.org"

lisp/modes/view-less.el

   "Non-nil when view-mode is active.  Call `view-mode' to toggle.")
 (make-variable-buffer-local 'view-minor-mode)
 
+;;;###autoload
 (defvar view-minor-mode-map
   (let ((map (make-keymap)))
     (set-keymap-name map 'view-minor-mode-map)
 
 (add-minor-mode 'view-minor-mode " View" view-minor-mode-map)
 
+;;;###autoload
 (defvar view-mode-map
   (let ((map (copy-keymap view-minor-mode-map)))
     (set-keymap-name map 'view-mode-map)

lisp/packages/apropos.el

 	  (apropos-print-doc 'describe-variable 2
 			     "Variable" do-keys)
 	  (apropos-print-doc 'apropos-describe-plist 3
-			     "Plist" nil))))
-    (when temp-buffer-shrink-to-fit
-      (shrink-window-if-larger-than-buffer (get-buffer-window "*Apropos*"))))
+			     "Plist" nil)))))
   (prog1 apropos-accumulator
     (setq apropos-accumulator ())))	; permit gc
 

lisp/packages/hyper-apropos.el

 			    ;; movement
 			    (define-key map " "     'scroll-up)
 			    (define-key map "b"     'scroll-down)
+			    (define-key map [delete] 'scroll-down)
+			    (define-key map [backspace] 'scroll-down)
 			    (define-key map "/"     'isearch-forward)
 			    (define-key map "?"     'isearch-backward)
 			    ;; follow links
 		       ;; slightly different scrolling...
 		       (define-key map " "     'hypropos-scroll-up)
 		       (define-key map "b"     'hypropos-scroll-down)
+		       (define-key map [delete] 'hypropos-scroll-down)
+		       (define-key map [backspace] 'hypropos-scroll-down)
 		       ;; act on the current line...
 		       (define-key map "w"     'hypropos-where-is)
 		       (define-key map "i"     'hypropos-invoke-fn)

lisp/packages/terminal.el

 		 (progn (goto-char (point-max))
 			(recenter -1)))))))
 
-(defvar te-stty-string "stty -nl new dec echo"
-  "Command string (to be interpreted by \"sh\") which sets the modes
-of the virtual terminal to be appropriate for interactive use.")
+(defvar te-stty-string "stty -nl erase '^?' kill '^u' intr '^c' echo pass8"
+  "Shell command to set terminal modes for terminal emulator.")
+;; This used to have `new' in it, but that loses outside BSD
+;; and it's apparently not needed in BSD.
 
 (defvar explicit-shell-file-name nil
   "*If non-nil, is file name to use for explicitly requested inferior shell.")

lisp/prim/about.el

 ;    (or got-error (message nil)))
 ;  )
 
+(defvar about-xref-alist
+  '((w3-xemacs   . "http://www.xemacs.org/")
+    (w3-jamie    . "http://www.netscape.com/people/jwz/")
+    (w3-baw      . "http://www.python.org/~bwarsaw/")
+    (w3-python   . "http://www.python.org/ftp/emacs/")
+    (w3-infodock . "http://www.infodock.com")
+    (w3-kyle     . "http://www.wonderworks.com/kyle/")
+    (w3-larsi    . "http://www.ifi.uio.no/~larsi/")
+    (w3-hrvoje   . "ftp://gnjilux.cc.fer.hr/pub/unix/util/wget/")
+    ;; add more here
+    )
+  "Mappings between xref symbols and URLs")
+
 (defun about-xemacs-xref ()
   (interactive "@")
   (let* ((e (or current-mouse-event last-input-event))
 	(setq prev-page 'about)
       ;; Kill the sub-buffers when going back to the top, so that we
       ;; don't hold pointers to the bitmaps longer than necessary.
-      (if (not (eq xref 'w3-jamie))
+      (if (not (assq xref about-xref-alist))
 	  (progn
 	    (kill-buffer (current-buffer))
 	    (setq prev-page 'others))))
       (about-xemacs))
      ((eq xref 'info)
       (info))
-     ((or (eq xref 'w3-xemacs) (eq xref 'w3-jamie))
+     ((assq xref about-xref-alist)
       (funcall browse-url-browser-function
-	       (if (eq xref 'w3-xemacs)
-		   "http://www.xemacs.org/"
-		 "http://www.netscape.com/people/jwz/")))
+	       (cdr (assq xref about-xref-alist))))
      ((eq xref 'kill-buffer)
       (kill-buffer (current-buffer)))
      ((eq xref 'news)
 			       ((eq xref 'others) "About Everyone")
 			       ((eq xref 'features) "New XEmacs Features")
 			       ((eq xref 'history) "XEmacs History")
+			       (t (error "Can't follow xref: %s" xref))
 			       )))
       (delete-other-windows)
       (buffer-disable-undo (current-buffer))
 	  (about-face "Barry Warsaw" 'bold)
 	  (insert " <bwarsaw@python.org>
 
-	Author of cc-mode for C++, C, and Objective-C editing, and
-	Supercite for mail and news citing.  Also various and sundry other
-	Emacs utilities, fixes, enhancements and kludgery as whimsy,
-	boredom, and ToT dictate (but not necessarily in that order).
-
-	See \"http://www.python.org/~bwarsaw\".
+	Author of CC Mode, for C, C++, Objective-C, and Java editing,
+	and Supercite for mail and news citing.  Also various and
+	sundry other Emacs packages, utilities, fixes, enhancements
+	and kludgery as whimsy, boredom, and ToT dictate (but not
+	necessarily in that order).  See also:\n
+                ")
+	  (about-xref "http://www.python.org/~bwarsaw/" 'w3-baw
+		      "Visit Barry's WWW page")
+	  (insert "\n	and:
+                ")
+	  (about-xref "http://www.python.org/ftp/emacs/" 'w3-python
+		      "Visit the CC Mode distribution")
+	  (insert "\n\n
 
 	Daddy
 	� 1994 Warsaw
-	========
+	=============
 	Drive me Daddy, drive me quick
 	Push my pedal, shift my stick
 	Fill me up with golden gas
 	framework for software engineers.  It runs atop XEmacs and is
 	available from his firm, InfoDock Associates, which offers custom
         development and support packages for corporate users of XEmacs,
-        GNU Emacs and InfoDock.  See \"http://www.infodock.com\".
+        GNU Emacs and InfoDock.  See ")
+	  (about-xref "http://www.infodock.com" 'w3-infodock
+		      "Visit the Infodock WWW page")
+	  (insert "
 	His interests include user interfaces, information management,
 	CASE tools, communications and enterprise integration.")
 
 	uses the standard UNIX mailbox format for its folders;
 	thus, you can use VM concurrently with other UNIX mail
 	readers such as Berkeley Mail and ELM.
-	See \"http://www.wonderworks.com/kyle/\".")
-
-	  (insert "\n\n\tClick ")
+	See ")
+	  (about-xref "http://www.wonderworks.com/kyle/" 'w3-kyle
+		      "Visit Kyle's WWW page")
+	  (insert ". \n\n\tClick ")
 	  (about-xref "here" prev-page "Return to previous page")
 	  (insert " to go back to the previous page.\n")
 	  )
 	currently plumbing away at his majors work at the Institute of
 	Physics, working on an SCI project connected with CASCADE and
 	CERN and stuff.
-	See \"http://www.ifi.uio.no/~larsi/\".")
+	See ")
+	  (about-xref "http://www.ifi.uio.no/~larsi/" 'w3-larsi
+		      "Visit Lars' WWW page")
 
-	  (insert "\n\n\tClick ")
+	  (insert ". \n\n\tClick ")
 	  (about-xref "here" prev-page "Return to previous page")
 	  (insert " to go back to the previous page.\n")
 	  )
 	  and back-seat contributor for several of it's major packages.
 
 	") (about-xref "Barry Warsaw" 'baw "Find out more about Barry Warsaw") (insert " <bwarsaw@python.org>
-	  Author of cc-mode for C++, C, and Objective-C editing, and
-	  Supercite for mail and news citing.  Also various and sundry other
-	  Emacs utilities, fixes, enhancements and kludgery as whimsy,
-	  boredom, and ToT dictate (but not necessarily in that order).
+	  Author of CC Mode for C, C++, Objective-C and Java editing,
+	  and Supercite for mail and news citing.  Also various and
+	  sundry other Emacs packages, utilities, fixes, enhancements
+	  and kludgery as whimsy, boredom, and ToT dictate (but not
+	  necessarily in that order).  See also:
+                ")
+	  (about-xref "http://www.python.org/~bwarsaw/" 'w3-baw
+		      "Visit Barry's WWW page")
+	  (insert "\n	  and:
+                ")
+	  (about-xref "http://www.python.org/ftp/emacs/" 'w3-python
+		      "Visit Barry's Emacs Goodies page")
+	  (insert "
 
 	") (about-xref "Andy Piper" 'piper "Find out more about Andy Piper") (insert " <andyp@parallax.co.uk>
 	  Created the prototype for the toolbars.  Has been the first to make
 	  framework for software engineers.