Commits

Anonymous committed 9f59509

Import from CVS: tag r20-1b10

Comments (0)

Files changed (239)

 (3) By hand.  Do
     cat info/xemacs* | more "+/^File: xemacs.info,  Node: Bugs,"
 
+
+Part II of the XEmacs FAQ, available in a manner similar to the above,
+or via the world wide web, contains extensive information on how to
+track down and report bugs.
+
+	http://www.xemacs.org/faq/
 							-*- indented-text -*-
+to 20.1 beta10
+-- custom-1.68 [Beyond 19.15]
+-- W3-3.0.75
+-- Documentation updates
+-- cc-mode-4.388
+-- Custom-1.67
+-- EFS fixes courtesy of Michael Sperber
+-- time.el-1.11
+-- Various cursor glitch patches courtesy of Darrell Kindred
+-- Irix -rpath support courtesy of Darrell Kindred
+-- Miscellaneous bug fixes
+-- EFS synch to 19.15 for default-dir.el
+-- hm--html-mode-5.5
+-- VM-6.22
+-- Gnus-5.4.37
+
 to 20.1 beta9
 -- VM-6.21
 -- tm-7.106
 -- floating-toolbar.el-1.02
 -- balloon-help.el-1.05
 -- W3-3.0.71
--- VM-6.20
 -- Custom-1.65
 -- Gnus-5.4.33
 -- strip unimplemented subwindows subr code
+Thu Mar 27 18:24:19 1997  Steven L Baur  <steve@altair.xemacs.org>
+
+	* XEmacs 20.1-b10 is released.
+
+Wed Mar 26 22:31:10 1997  Steven L Baur  <steve@altair.xemacs.org>
+
+	* Remove vms top-level directory.
+	
+	* XEmacs 19.15 final released to beta testers.
+
+Tue Mar 25 19:13:27 1997  Steven L Baur  <steve@altair.xemacs.org>
+
+	* XEmacs 19.15 prefinal released to beta testers.
+
+Mon Mar 24 12:28:17 1997  Steven L Baur  <steve@altair.xemacs.org>
+
+	* configure.in (--debug): Correct documentation.
+
+Sun Mar 23 17:24:38 1997  Steven L Baur  <steve@altair.xemacs.org>
+
+	* XEmacs 19.15-b104 is released.
+
+Sat Mar 22 19:56:36 1997  Steven L Baur  <steve@altair.xemacs.org>
+
+	* etc/sgml/CATALOG: Default to html-3.2final.
+
+Sat Mar 22 17:55:15 1997  Darrell Kindred  <dkindred@cmu.edu>
+
+	* configure.in (beta): Add configure support for the -rpath flag
+	for IRIX analogous to the Solaris "-R".
+
+Sat Mar 22 16:47:08 1997  Steven L Baur  <steve@altair.xemacs.org>
+
+	* info/dir (Packages): Add HM-HTML-Mode to menu.
+
+Sat Mar 22 21:27:41 1997  Tomasz J. Cholewo  <t.cholewo@ieee.org>
+
+        * configure.in: Echo only current configuration using 'tee -a'.
+
 Fri Mar 21 21:26:01 1997  Steven L Baur  <steve@altair.xemacs.org>
 
 	* XEmacs-19.15-b103 is released.
 The is seen when installing the Big Brother Data Base (bbdb) which
 includes an outdated copy of mail-abbrevs.el.  Remove the copy that
 comes with bbdb and use the one that comes with XEmacs.
+
+* Linking with -rpath on IRIX.
+
+Darrell Kindred <dkindred@cmu.edu> writes:
+There are a couple of problems [with use of -rpath with Irix ld], though:
+
+  1. The ld in IRIX 5.3 ignores all but the last -rpath
+     spec, so the patched configure spits out a warning
+     if --x-libraries or --site-runtime-libraries are
+     specified under irix 5.x, and it only adds -rpath 
+     entries for the --site-runtime-libraries.  This bug was
+     fixed sometime between 5.3 and 6.2.
+
+  2. IRIX gcc 2.7.2 doesn't accept -rpath directly, so
+     it would have to be prefixed by -Xlinker or "-Wl,".
+     This would be fine, except that configure compiles with
+        ${CC-cc} $CFLAGS $LDFLAGS ...
+     rather than quoting $LDFLAGS with prefix-args, like
+     src/Makefile does.  So if you specify --x-libraries
+     or --site-runtime-libraries, you must use --use-gcc=no,
+     or configure will fail.
+
+* On Irix 5.x and 6.x, the dumped XEmacs (xemacs) core dumps when executed 
+  on another machine, or after newer SGI IRIX patches have been installed.
+
+The xemacs binary must be executed with the same "libc.so" file which was used 
+when the xemacs binary was dumped.  Some SGI IRIX patches update this file.
+Make sure that all machines using the xemacs binary are using the same
+set of IRIX patches.  If xemacs core dumps after a patch upgrade then you 
+will have to redump it from temacs.
+
+* xemacs: can't resolve symbol '__malloc_hook'
+
+This is a Linux problem where you've compiled the XEmacs binary on a libc
+5.4 with version higher than 5.4.19 and attempted to run the binary against
+an earlier version.  The solution is to upgrade your old library.
+
+* VM appears to hang in large folders
+
+This is normal (trust us) when upgrading to VM-6.22 from earlier versions.
+Let VM finish what it is doing and all will be well.
 Debugging options:
 
 --debug			Compile with support for debugging XEmacs.
-			(Causes code-size increase but no loss of speed.)
+			(Causes code-size increase and little loss of speed.)
 --error-checking=TYPE[,TYPE]...
 			Compile with internal error-checking added.
 			Causes noticeable loss of speed.  Valid types
   with_toolbars='yes'
 fi
 
+runtime_arg="-R${dash_r_space}"
+
 case "${canonical}" in
-  *-sun-solaris* | *-sun-sunos5* ) add_runtime_flag=yes ;;
+  *-sun-solaris* | *-sun-sunos5* ) 
+    add_runtime_flag=yes ;;
+  *-sgi-irix5.* )
+    # In the IRIX 5.3 ld, only the last -rpath arg has any effect.  This is 
+    # fundamentaly incompatible with having separate LD_SWITCH_X_SITE
+    # and LD_SWITCH_SITE variables.  Fortunately, SGI fixed this by 6.2.
+    if [ -n "${x_libraries}" ] || [ -n "${site_runtime_libraries}" ]; then
+      (echo "WARNING: The IRIX 5 ld ignores all but the last -rpath argument,";
+       echo "         so if you need to specify more than one additional";
+       echo "         runtime library directory, you will have to do so";
+       echo "         manually by setting the environment variable";
+       echo "         LD_SWITCH_SITE to '-rpath <path>' before running";
+       echo "         configure.  If you have only one additional directory,"
+       echo "         you can specify it with --site-runtime-libraries.") >&2
+    fi
+    runtime_arg="-rpath " ;;
+  *-sgi-irix* )
+    # Note that IRIX gcc (as of 2.7.2) doesn't accept -rpath, so
+    # using it can cause trouble.  Specifying --use-gcc=no will work 
+    # around this, but the real problem is that configure uses $LDFLAGS 
+    # as arguments to $(CC), instead of using prefix-args like the
+    # src/Makefile does.
+    add_runtime_flag=yes;
+    runtime_arg="-rpath " ;;
 esac
 
 if test -n "${x_libraries}" ; then
-  if test "${add_runtime_flag}" ; then
-    LD_SWITCH_X_SITE="-L${x_libraries} -R${dash_r_space}${x_libraries}"
+    if test "${add_runtime_flag}" = "yes" ; then
+	LD_SWITCH_X_SITE="-L${x_libraries} ${runtime_arg}${x_libraries}"
   else
     LD_SWITCH_X_SITE="-L${x_libraries}"
   fi
   for arg in ${site_runtime_libraries}
   do
     LD_SWITCH_SITE="${LD_SWITCH_SITE} -L${arg}"
-    LD_SWITCH_SITE="${LD_SWITCH_SITE} -R${dash_r_space}${arg}"
+    LD_SWITCH_SITE="${LD_SWITCH_SITE} ${runtime_arg}${arg}"
   done
 fi
 if test -n "${site_includes}" ; then
 CPP=`eval "echo $CPP"`
 eval `${CPP} -Isrc ${tempcname} \
        | grep 'configure___' \
-       | sed -n -e 's/^configure___ \([^=]*=\)\(.*\)$/\1"\2"/p'`
+       | sed -n -e 's/^configure___ \(^=*=\)\(.*\)$/\1"\2"/p'`
 if test "x$SPECIFIED_CFLAGS" = x ; then
   eval `${CPP} -Isrc -DTHIS_IS_CONFIGURE ${tempcname} \
 	 | grep 'configure___' \
-	 | sed -n -e 's/^configure___ \([^=]*=\)\(.*\)$/\1"\2"/p'`
+	 | sed -n -e 's/^configure___ \(^=*=\)\(.*\)$/\1"\2"/p'`
 else
   REAL_CFLAGS="$CFLAGS"
 fi
 
 #### Add the libraries to LIBS and check for some functions.
 
-
+]
 CPPFLAGS="${C_SWITCH_SITE} $c_switch_system $c_switch_machine $c_switch_x_system $CPPFLAGS"
 DEFS="${C_SWITCH_SITE} $c_switch_system $c_switch_machine $c_switch_x_system $DEFS"
 LIBS="${LD_SWITCH_SITE} $ld_switch_x_system $libsrc_libs $LIBS"
     case "${arg}" in
 	-L*) if test -f `echo "${arg}/libtt.a" | sed 's/^\-L//'` ; then
 		 dash_r=''
-		 if test -n "${add_runtime_flag}" ; then
-		     dash_r=`echo ${arg} | sed "s/^-L/-R${dash_r_space}/"`
+		 if  "${add_runtime_flag}" = "yes" ; then
+		     dash_r=`echo ${arg} | sed "s/^-L */${runtime_arg}/"`
 		 fi
 		 LD_SWITCH_X_SITE="${LD_SWITCH_X_SITE} ${arg} ${dash_r}"
 	     fi
 
 
 
+echo "$0 $configure_args" >> Installation
+# Start stdout redirection to '| tee -a Installation'
+(
 echo "
 
 Configured for \`${canonical}'.
   Should XEmacs use the relocating allocator for buffers? ${rel_alloc}
   What window system should XEmacs use?                   ${window_system}${x_includes+
   Where do we find X Windows header files?                }${x_includes}${x_libraries+
-  Where do we find X Windows libraries?                   }${x_libraries}" >> Installation
+  Where do we find X Windows libraries?                   }${x_libraries}"
 
 if test -n "$site_includes"; then
-  echo "  Additional header files:                                ${site_includes}" >> Installation
+  echo "  Additional header files:                                ${site_includes}"
 fi
 
 if test -n "$site_libraries" -a -n "$site_runtime_libraries"; then
-  echo "  Additional libraries:                                   ${site_libraries} ${site_runtime_libraries}" >> Installation
+  echo "  Additional libraries:                                   ${site_libraries} ${site_runtime_libraries}"
 elif test -n "$site_libraries"; then
-  echo "  Additional libraries:                                   ${site_libraries}" >> Installation
+  echo "  Additional libraries:                                   ${site_libraries}"
 elif test -n "$site_runtime_libraries"; then
-  echo "  Additional libraries:                                   ${site_runtime_libraries}" >> Installation
+  echo "  Additional libraries:                                   ${site_runtime_libraries}"
 fi
 if test "$with_wnn"; then
-  echo "  Finding WNN includes with:                              ${wnn_includes}" >> Installation
-  echo "  Loading WNN libs with:                                  ${wnn_libraries}" >> Installation
-fi
-test "$with_socks" = yes && echo "  Compiling in support for SOCKS." >> Installation
-test "$with_term"  = yes && echo "  Compiling in support for TERM." >> Installation
-test "$with_xauth" = yes && echo "  Compiling in support for XAUTH." >> Installation
-test "$with_xpm"   = yes && echo "  Compiling in support for XPM." >> Installation
+  echo "  Finding WNN includes with:                              ${wnn_includes}"
+  echo "  Loading WNN libs with:                                  ${wnn_libraries}"
+fi
+test "$with_socks" = yes && echo "  Compiling in support for SOCKS."
+test "$with_term"  = yes && echo "  Compiling in support for TERM."
+test "$with_xauth" = yes && echo "  Compiling in support for XAUTH."
+test "$with_xpm"   = yes && echo "  Compiling in support for XPM."
 if test "$with_xmu" != yes -a "$window_system" != none; then
-  echo "  No Xmu; substituting equivalent routines." >> Installation
-fi
-test "$with_xface" = yes && echo "  Compiling in support for X-Face headers." >> Installation
-test "$with_gif"   = yes && echo "  Compiling in support for GIF image conversion." >> Installation
-test "$with_jpeg"  = yes && echo "  Compiling in support for JPEG image conversion." >> Installation
+  echo "  No Xmu; substituting equivalent routines."
+fi
+test "$with_xface" = yes && echo "  Compiling in support for X-Face headers."
+test "$with_gif"   = yes && echo "  Compiling in support for GIF image conversion."
+test "$with_jpeg"  = yes && echo "  Compiling in support for JPEG image conversion."
 if test "$with_png"   = yes -o "$with_png" = gnuz; then
-  echo "  Compiling in support for PNG image conversion." >> Installation
+  echo "  Compiling in support for PNG image conversion."
 fi
 if test "$with_png" = gnuz; then
-  echo "  (Using -lgz instead of -lz.)" >> Installation
-fi
-test "$with_tiff"  = yes && echo "  Compiling in support for TIFF image conversion (not implemented)." >> Installation
-test "$with_epoch" = yes && echo "  Compiling in extra Epoch compatibility." >> Installation
-
-test "$with_sound" = nas    && echo "  Compiling in network sound support." >> Installation
-test "$with_sound" = native && echo "  Compiling in native sound support." >> Installation
-test "$with_sound" = both   && echo "  Compiling in both network and native sound support." >> Installation
-test "$old_nas"    = true   && echo "        nas library lacks error trapping, will play synchronously" >> Installation
-
-test "$with_database_berkdb" = yes && echo "  Compiling in support for Berkeley DB." >> Installation
-test "$with_database_dbm"    = yes && echo "  Compiling in support for DBM." >> Installation
-test "$with_database_gnudbm" = yes && echo "  Compiling in support for GNU DBM." >> Installation
-
-test "$with_ncurses"  = yes && echo "  Compiling in support for ncurses." >> Installation
-test "$with_socks"    = yes && echo "  Compiling in support for SOCKS." >> Installation
-
-test "$with_mule"     = yes && echo "  Compiling in Mule (multi-lingual) support." >> Installation
-test "$with_xim"      != no && echo "  Compiling in XIM (X11R5+ I18N input method) support." >> Installation
-test "$with_xim" = motif    && echo "    Using Motif to provide XIM support." >> Installation
-test "$with_xim" = xlib     && echo "    Using raw Xlib to provide XIM support." >> Installation
-test "$with_canna"    = yes && echo "  Compiling in support for Canna on Mule." >> Installation
-test "$with_wnn"      = yes && echo "  Compiling in support for WNN on Mule." >> Installation
-test "$with_wnn6"     = yes && echo "  WNN support for version 6." >> Installation
-test "$with_i18n3"    = yes && echo "  Compiling in I18N support, level 3 (doesn't currently work)." >> Installation
-
-test "$with_cde"      = yes && echo "  Compiling in support for CDE." >> Installation
-test "$with_tooltalk" = yes && echo "  Compiling in support for ToolTalk." >> Installation
-test "$with_offix"    = yes && echo "  Compiling in support for OffiX." >> Installation
-test "$with_mocklisp" = yes && echo "  Compiling in support for Mocklisp." >> Installation
-test "$with_sparcworks" = yes && echo "  Compiling in support for SparcWorks." >> Installation
-test "$with_energize" = yes && echo "  Compiling in support for Lucid Energize (doesn't currently work)." >> Installation
-test "$with_menubars" = "lucid" && echo "  Using the Lucid menubar." >> Installation
+  echo "  (Using -lgz instead of -lz.)"
+fi
+test "$with_tiff"  = yes && echo "  Compiling in support for TIFF image conversion (not implemented)."
+test "$with_epoch" = yes && echo "  Compiling in extra Epoch compatibility."
+
+test "$with_sound" = nas    && echo "  Compiling in network sound support."
+test "$with_sound" = native && echo "  Compiling in native sound support."
+test "$with_sound" = both   && echo "  Compiling in both network and native sound support."
+test "$old_nas"    = true   && echo "        nas library lacks error trapping, will play synchronously"
+
+test "$with_database_berkdb" = yes && echo "  Compiling in support for Berkeley DB."
+test "$with_database_dbm"    = yes && echo "  Compiling in support for DBM."
+test "$with_database_gnudbm" = yes && echo "  Compiling in support for GNU DBM."
+
+test "$with_ncurses"  = yes && echo "  Compiling in support for ncurses."
+test "$with_socks"    = yes && echo "  Compiling in support for SOCKS."
+
+test "$with_mule"     = yes && echo "  Compiling in Mule (multi-lingual) support."
+test "$with_xim"      != no && echo "  Compiling in XIM (X11R5+ I18N input method) support."
+test "$with_xim" = motif    && echo "    Using Motif to provide XIM support."
+test "$with_xim" = xlib     && echo "    Using raw Xlib to provide XIM support."
+test "$with_canna"    = yes && echo "  Compiling in support for Canna on Mule."
+test "$with_wnn"      = yes && echo "  Compiling in support for WNN on Mule."
+test "$with_wnn6"     = yes && echo "  WNN support for version 6."
+test "$with_i18n3"    = yes && echo "  Compiling in I18N support, level 3 (doesn't currently work)."
+
+test "$with_cde"      = yes && echo "  Compiling in support for CDE."
+test "$with_tooltalk" = yes && echo "  Compiling in support for ToolTalk."
+test "$with_offix"    = yes && echo "  Compiling in support for OffiX."
+test "$with_mocklisp" = yes && echo "  Compiling in support for Mocklisp."
+test "$with_sparcworks" = yes && echo "  Compiling in support for SparcWorks."
+test "$with_energize" = yes && echo "  Compiling in support for Lucid Energize (doesn't currently work)."
+test "$with_menubars" = "lucid" && echo "  Using the Lucid menubar."
 if test "$with_menubars" = "motif"; then
-  echo "  Using the Motif menubar." >> Installation
-  echo " *WARNING*  The Motif menubar is currently buggy.  We recommend" >> Installation
-  echo "            that you use the Lucid menubar instead.  Re-run" >> Installation
-  echo "            configure with --with-menubars='lucid'." >> Installation
-fi
-test "$with_scrollbars" = lucid  && echo "  Using the Lucid scrollbar." >> Installation
-test "$with_scrollbars" = motif  && echo "  Using the Motif scrollbar." >> Installation
-test "$with_scrollbars" = athena && echo "  Using the Athena scrollbar." >> Installation
-test "$with_scrollbars" = athena3d && echo "  Using the Athena-3d scrollbar." >> Installation
-test "$with_dialogs"    = motif  && echo "  Using the Motif dialog boxes." >> Installation
-test "$with_dialogs"    = athena && echo "  Using the Athena dialog boxes." >> Installation
-test "$with_dialogs"    = athena3d && echo "  Using the Athena-3d dialog boxes." >> Installation
-
-test "${use_union_type}"     = yes && echo "  Using the union type for Lisp_Objects." >> Installation
-test "${debug}"              = yes && echo "  Compiling in extra code for debugging." >> Installation
-test "${memory_usage_stats}" = yes && echo "  Compiling in code for checking XEmacs memory usage." >> Installation
-test "$usage_tracking"       = yes && echo "  Compiling with usage tracking active (Sun internal)." >> Installation
-echo " >> Installation
-"
-
-test -r Installation && cat Installation
+  echo "  Using the Motif menubar."
+  echo " *WARNING*  The Motif menubar is currently buggy.  We recommend"
+  echo "            that you use the Lucid menubar instead.  Re-run"
+  echo "            configure with --with-menubars='lucid'."
+fi
+test "$with_scrollbars" = lucid  && echo "  Using the Lucid scrollbar."
+test "$with_scrollbars" = motif  && echo "  Using the Motif scrollbar."
+test "$with_scrollbars" = athena && echo "  Using the Athena scrollbar."
+test "$with_scrollbars" = athena3d && echo "  Using the Athena-3d scrollbar."
+test "$with_dialogs"    = motif  && echo "  Using the Motif dialog boxes."
+test "$with_dialogs"    = athena && echo "  Using the Athena dialog boxes."
+test "$with_dialogs"    = athena3d && echo "  Using the Athena-3d dialog boxes."
+
+test "${use_union_type}"     = yes && echo "  Using the union type for Lisp_Objects."
+test "${debug}"              = yes && echo "  Compiling in extra code for debugging."
+test "${memory_usage_stats}" = yes && echo "  Compiling in code for checking XEmacs memory usage."
+test "$usage_tracking"       = yes && echo "  Compiling with usage tracking active (Sun internal)."
+) | tee -a Installation
+echo " | tee -a Installation
+"
 
  
 # Remove any trailing slashes in these variables.
 Debugging options:
 
 --debug			Compile with support for debugging XEmacs.
-			(Causes code-size increase but no loss of speed.)
+			(Causes code-size increase and little loss of speed.)
 --error-checking=TYPE[,TYPE]...
 			Compile with internal error-checking added.
 			Causes noticeable loss of speed.  Valid types
   with_toolbars='yes'
 fi
 [
+runtime_arg="-R${dash_r_space}"
+
 case "${canonical}" in
-  *-sun-solaris* | *-sun-sunos5* ) add_runtime_flag=yes ;;
+  *-sun-solaris* | *-sun-sunos5* ) 
+    add_runtime_flag=yes ;;
+  *-sgi-irix5.* )
+    # In the IRIX 5.3 ld, only the last -rpath arg has any effect.  This is 
+    # fundamentaly incompatible with having separate LD_SWITCH_X_SITE
+    # and LD_SWITCH_SITE variables.  Fortunately, SGI fixed this by 6.2.
+    if [ -n "${x_libraries}" ] || [ -n "${site_runtime_libraries}" ]; then
+      (echo "WARNING: The IRIX 5 ld ignores all but the last -rpath argument,";
+       echo "         so if you need to specify more than one additional";
+       echo "         runtime library directory, you will have to do so";
+       echo "         manually by setting the environment variable";
+       echo "         LD_SWITCH_SITE to '-rpath <path>' before running";
+       echo "         configure.  If you have only one additional directory,"
+       echo "         you can specify it with --site-runtime-libraries.") >&2
+    fi
+    runtime_arg="-rpath " ;;
+  *-sgi-irix* )
+    # Note that IRIX gcc (as of 2.7.2) doesn't accept -rpath, so
+    # using it can cause trouble.  Specifying --use-gcc=no will work 
+    # around this, but the real problem is that configure uses $LDFLAGS 
+    # as arguments to $(CC), instead of using prefix-args like the
+    # src/Makefile does.
+    add_runtime_flag=yes;
+    runtime_arg="-rpath " ;;
 esac
 
 if test -n "${x_libraries}" ; then
-  if test "${add_runtime_flag}" ; then
-    LD_SWITCH_X_SITE="-L${x_libraries} -R${dash_r_space}${x_libraries}"
+    if test "${add_runtime_flag}" = "yes" ]; then
+	LD_SWITCH_X_SITE="-L${x_libraries} ${runtime_arg}${x_libraries}"
   else
     LD_SWITCH_X_SITE="-L${x_libraries}"
   fi
   for arg in ${site_runtime_libraries}
   do
     LD_SWITCH_SITE="${LD_SWITCH_SITE} -L${arg}"
-    LD_SWITCH_SITE="${LD_SWITCH_SITE} -R${dash_r_space}${arg}"
+    LD_SWITCH_SITE="${LD_SWITCH_SITE} ${runtime_arg}${arg}"
   done
 fi
 if test -n "${site_includes}" ; then
     case "${arg}" in
 	-L*) if test -f `echo "${arg}/libtt.a" | sed 's/^\-L//'` ; then
 		 dash_r=''
-		 if test -n "${add_runtime_flag}" ; then
-		     dash_r=`echo ${arg} | sed "s/^-L/-R${dash_r_space}/"`
+		 if [ "${add_runtime_flag}" = "yes" ]; then
+		     dash_r=`echo ${arg} | sed "s/^-L */${runtime_arg}/"`
 		 fi
 		 LD_SWITCH_X_SITE="${LD_SWITCH_X_SITE} ${arg} ${dash_r}"
 	     fi
 dnl #                     Report on what we decided to do                      #
 dnl ############################################################################
 
+echo "$0 $configure_args" >> Installation
+# Start stdout redirection to '| tee -a Installation'
+(
 echo "
 
 Configured for \`${canonical}'.
   Should XEmacs use the relocating allocator for buffers? ${rel_alloc}
   What window system should XEmacs use?                   ${window_system}${x_includes+
   Where do we find X Windows header files?                }${x_includes}${x_libraries+
-  Where do we find X Windows libraries?                   }${x_libraries}" >> Installation
+  Where do we find X Windows libraries?                   }${x_libraries}"
 
 if test -n "$site_includes"; then
-  echo "  Additional header files:                                ${site_includes}" >> Installation
+  echo "  Additional header files:                                ${site_includes}"
 fi
 
 if test -n "$site_libraries" -a -n "$site_runtime_libraries"; then
-  echo "  Additional libraries:                                   ${site_libraries} ${site_runtime_libraries}" >> Installation
+  echo "  Additional libraries:                                   ${site_libraries} ${site_runtime_libraries}"
 elif test -n "$site_libraries"; then
-  echo "  Additional libraries:                                   ${site_libraries}" >> Installation
+  echo "  Additional libraries:                                   ${site_libraries}"
 elif test -n "$site_runtime_libraries"; then
-  echo "  Additional libraries:                                   ${site_runtime_libraries}" >> Installation
+  echo "  Additional libraries:                                   ${site_runtime_libraries}"
 fi
 if test "$with_wnn"; then
-  echo "  Finding WNN includes with:                              ${wnn_includes}" >> Installation
-  echo "  Loading WNN libs with:                                  ${wnn_libraries}" >> Installation
+  echo "  Finding WNN includes with:                              ${wnn_includes}"
+  echo "  Loading WNN libs with:                                  ${wnn_libraries}"
 fi
-test "$with_socks" = yes && echo "  Compiling in support for SOCKS." >> Installation
-test "$with_term"  = yes && echo "  Compiling in support for TERM." >> Installation
-test "$with_xauth" = yes && echo "  Compiling in support for XAUTH." >> Installation
-test "$with_xpm"   = yes && echo "  Compiling in support for XPM." >> Installation
+test "$with_socks" = yes && echo "  Compiling in support for SOCKS."
+test "$with_term"  = yes && echo "  Compiling in support for TERM."
+test "$with_xauth" = yes && echo "  Compiling in support for XAUTH."
+test "$with_xpm"   = yes && echo "  Compiling in support for XPM."
 if test "$with_xmu" != yes -a "$window_system" != none; then
-  echo "  No Xmu; substituting equivalent routines." >> Installation
+  echo "  No Xmu; substituting equivalent routines."
 fi
-test "$with_xface" = yes && echo "  Compiling in support for X-Face headers." >> Installation
-test "$with_gif"   = yes && echo "  Compiling in support for GIF image conversion." >> Installation
-test "$with_jpeg"  = yes && echo "  Compiling in support for JPEG image conversion." >> Installation
+test "$with_xface" = yes && echo "  Compiling in support for X-Face headers."
+test "$with_gif"   = yes && echo "  Compiling in support for GIF image conversion."
+test "$with_jpeg"  = yes && echo "  Compiling in support for JPEG image conversion."
 if test "$with_png"   = yes -o "$with_png" = gnuz; then
-  echo "  Compiling in support for PNG image conversion." >> Installation
+  echo "  Compiling in support for PNG image conversion."
 fi
 if test "$with_png" = gnuz; then
-  echo "  (Using -lgz instead of -lz.)" >> Installation
+  echo "  (Using -lgz instead of -lz.)"
 fi
-test "$with_tiff"  = yes && echo "  Compiling in support for TIFF image conversion (not implemented)." >> Installation
-test "$with_epoch" = yes && echo "  Compiling in extra Epoch compatibility." >> Installation
-
-test "$with_sound" = nas    && echo "  Compiling in network sound support." >> Installation
-test "$with_sound" = native && echo "  Compiling in native sound support." >> Installation
-test "$with_sound" = both   && echo "  Compiling in both network and native sound support." >> Installation
-test "$old_nas"    = true   && echo "        nas library lacks error trapping, will play synchronously" >> Installation
-
-test "$with_database_berkdb" = yes && echo "  Compiling in support for Berkeley DB." >> Installation
-test "$with_database_dbm"    = yes && echo "  Compiling in support for DBM." >> Installation
-test "$with_database_gnudbm" = yes && echo "  Compiling in support for GNU DBM." >> Installation
-
-test "$with_ncurses"  = yes && echo "  Compiling in support for ncurses." >> Installation
-test "$with_socks"    = yes && echo "  Compiling in support for SOCKS." >> Installation
-
-test "$with_mule"     = yes && echo "  Compiling in Mule (multi-lingual) support." >> Installation
-test "$with_xim"      != no && echo "  Compiling in XIM (X11R5+ I18N input method) support." >> Installation
-test "$with_xim" = motif    && echo "    Using Motif to provide XIM support." >> Installation
-test "$with_xim" = xlib     && echo "    Using raw Xlib to provide XIM support." >> Installation
-test "$with_canna"    = yes && echo "  Compiling in support for Canna on Mule." >> Installation
-test "$with_wnn"      = yes && echo "  Compiling in support for WNN on Mule." >> Installation
-test "$with_wnn6"     = yes && echo "  WNN support for version 6." >> Installation
-test "$with_i18n3"    = yes && echo "  Compiling in I18N support, level 3 (doesn't currently work)." >> Installation
-
-test "$with_cde"      = yes && echo "  Compiling in support for CDE." >> Installation
-test "$with_tooltalk" = yes && echo "  Compiling in support for ToolTalk." >> Installation
-test "$with_offix"    = yes && echo "  Compiling in support for OffiX." >> Installation
-test "$with_mocklisp" = yes && echo "  Compiling in support for Mocklisp." >> Installation
-test "$with_sparcworks" = yes && echo "  Compiling in support for SparcWorks." >> Installation
-test "$with_energize" = yes && echo "  Compiling in support for Lucid Energize (doesn't currently work)." >> Installation
-test "$with_menubars" = "lucid" && echo "  Using the Lucid menubar." >> Installation
+test "$with_tiff"  = yes && echo "  Compiling in support for TIFF image conversion (not implemented)."
+test "$with_epoch" = yes && echo "  Compiling in extra Epoch compatibility."
+
+test "$with_sound" = nas    && echo "  Compiling in network sound support."
+test "$with_sound" = native && echo "  Compiling in native sound support."
+test "$with_sound" = both   && echo "  Compiling in both network and native sound support."
+test "$old_nas"    = true   && echo "        nas library lacks error trapping, will play synchronously"
+
+test "$with_database_berkdb" = yes && echo "  Compiling in support for Berkeley DB."
+test "$with_database_dbm"    = yes && echo "  Compiling in support for DBM."
+test "$with_database_gnudbm" = yes && echo "  Compiling in support for GNU DBM."
+
+test "$with_ncurses"  = yes && echo "  Compiling in support for ncurses."
+test "$with_socks"    = yes && echo "  Compiling in support for SOCKS."
+
+test "$with_mule"     = yes && echo "  Compiling in Mule (multi-lingual) support."
+test "$with_xim"      != no && echo "  Compiling in XIM (X11R5+ I18N input method) support."
+test "$with_xim" = motif    && echo "    Using Motif to provide XIM support."
+test "$with_xim" = xlib     && echo "    Using raw Xlib to provide XIM support."
+test "$with_canna"    = yes && echo "  Compiling in support for Canna on Mule."
+test "$with_wnn"      = yes && echo "  Compiling in support for WNN on Mule."
+test "$with_wnn6"     = yes && echo "  WNN support for version 6."
+test "$with_i18n3"    = yes && echo "  Compiling in I18N support, level 3 (doesn't currently work)."
+
+test "$with_cde"      = yes && echo "  Compiling in support for CDE."
+test "$with_tooltalk" = yes && echo "  Compiling in support for ToolTalk."
+test "$with_offix"    = yes && echo "  Compiling in support for OffiX."
+test "$with_mocklisp" = yes && echo "  Compiling in support for Mocklisp."
+test "$with_sparcworks" = yes && echo "  Compiling in support for SparcWorks."
+test "$with_energize" = yes && echo "  Compiling in support for Lucid Energize (doesn't currently work)."
+test "$with_menubars" = "lucid" && echo "  Using the Lucid menubar."
 if test "$with_menubars" = "motif"; then
-  echo "  Using the Motif menubar." >> Installation
-  echo " *WARNING*  The Motif menubar is currently buggy.  We recommend" >> Installation
-  echo "            that you use the Lucid menubar instead.  Re-run" >> Installation
-  echo "            configure with --with-menubars='lucid'." >> Installation
+  echo "  Using the Motif menubar."
+  echo " *WARNING*  The Motif menubar is currently buggy.  We recommend"
+  echo "            that you use the Lucid menubar instead.  Re-run"
+  echo "            configure with --with-menubars='lucid'."
 fi
-test "$with_scrollbars" = lucid  && echo "  Using the Lucid scrollbar." >> Installation
-test "$with_scrollbars" = motif  && echo "  Using the Motif scrollbar." >> Installation
-test "$with_scrollbars" = athena && echo "  Using the Athena scrollbar." >> Installation
-test "$with_scrollbars" = athena3d && echo "  Using the Athena-3d scrollbar." >> Installation
-test "$with_dialogs"    = motif  && echo "  Using the Motif dialog boxes." >> Installation
-test "$with_dialogs"    = athena && echo "  Using the Athena dialog boxes." >> Installation
-test "$with_dialogs"    = athena3d && echo "  Using the Athena-3d dialog boxes." >> Installation
-
-test "${use_union_type}"     = yes && echo "  Using the union type for Lisp_Objects." >> Installation
-test "${debug}"              = yes && echo "  Compiling in extra code for debugging." >> Installation
-test "${memory_usage_stats}" = yes && echo "  Compiling in code for checking XEmacs memory usage." >> Installation
-test "$usage_tracking"       = yes && echo "  Compiling with usage tracking active (Sun internal)." >> Installation
-echo " >> Installation
+test "$with_scrollbars" = lucid  && echo "  Using the Lucid scrollbar."
+test "$with_scrollbars" = motif  && echo "  Using the Motif scrollbar."
+test "$with_scrollbars" = athena && echo "  Using the Athena scrollbar."
+test "$with_scrollbars" = athena3d && echo "  Using the Athena-3d scrollbar."
+test "$with_dialogs"    = motif  && echo "  Using the Motif dialog boxes."
+test "$with_dialogs"    = athena && echo "  Using the Athena dialog boxes."
+test "$with_dialogs"    = athena3d && echo "  Using the Athena-3d dialog boxes."
+
+test "${use_union_type}"     = yes && echo "  Using the union type for Lisp_Objects."
+test "${debug}"              = yes && echo "  Compiling in extra code for debugging."
+test "${memory_usage_stats}" = yes && echo "  Compiling in code for checking XEmacs memory usage."
+test "$usage_tracking"       = yes && echo "  Compiling with usage tracking active (Sun internal)."
+) | tee -a Installation
+echo " | tee -a Installation
 "
-
-test -r Installation && cat Installation
 dnl ############################################################################
 dnl #                                Now generate!                             #
 dnl ############################################################################
 								-*- text -*-
 
-	   XEmacs availability information.  Last Modified: 10-feb-96.
+	   XEmacs availability information.  Last Modified: 25-Mar-1997.
 
 XEmacs is available via anonymous FTP from ftp.xemacs.org (128.174.252.16)
 in the directory /pub/xemacs/.
 ftp.xemacs.org is the primary distribution point, but you may find
 copies of it at other sites as well.  Some sites to try include:
 
-	ftp.ai.mit.edu:/pub/xemacs/
-	ftp.uu.net:/systems/gnu/xemacs/
-	ftp.sunet.se:/pub/gnu/xemacs/
-	ftp.cenatls.cena.dgac.fr:/pub/Emacs/xemacs/
-	liasun3.epfl.ch:/pub/gnu/xemacs/
-	ftp.th-darmstadt.de:/pub/editors/xemacs/
-	audrey.levels.unisa.edu.au:/xemacs/
-	sunsite.doc.ic.ac.uk:/gnu/xemacs/
-	uiarchive.cso.uiuc.edu:/pub/packages/xemacs/
-	ftp.technion.ac.il:/pub/unsupported/gnu/xemacs/
-	thphys.irb.hr:/pub/xemacs/
+	ftp://ftp.ai.mit.edu:/pub/xemacs/
+	ftp://ftp-digital.cern.ch:/pub/beta/xemacs-20.0/
+	ftp://ftp.uu.net:/systems/gnu/xemacs/
+	ftp://ftp.sunet.se:/pub/gnu/xemacs/
+	ftp://tp.cenatls.cena.dgac.fr:/pub/Emacs/xemacs/
+	ftp://ftp.th-darmstadt.de:/pub/editors/xemacs/
+	ftp://sunsite.doc.ic.ac.uk:/gnu/xemacs/
+	ftp://ftp.ibp.fr:/pub/emacs/xemacs/
+	ftp://uiarchive.cso.uiuc.edu:/pub/packages/xemacs/
+	ftp://ftp.technion.ac.il:/pub/unsupported/gnu/xemacs/
+	ftp://thphys.irb.hr:/pub/xemacs/
+	ftp://sunsite.cnlab-switch.ch/mirror/xemacs/
+	ftp://ftp.unicamp.br:/pub/xemacs/r20.0/
+	ftp://ftp.usyd.edu.au:/pub/Xemacs/
+	ftp://ftp.lab.kdd.co.jp/xemacs/
+	ftp://SunSITE.sut.ac.jp/pub/archives/xemacs/
+
 
 The most up-to-date list of distribution sites can always be found on
 the XEmacs WWW page, http://www.xemacs.org/.  Try to pick a site
 
 New users should look at the next section on "Using Outline Mode".  You will
 be more efficient when you can navigate quickly through this file.  Users
-interested in some of the details of how XEmacs differs from FSF GNU Emacs
+interested in some of the details of how XEmacs differs from GNU Emacs
 should read the section "What's Different?".  Users who would to know which
 capabilities have been introduced in each release should look at the
 appropriate subsection of the "XEmacs Release Notes."
 ===================
 
 
-** Differences between XEmacs and FSF GNU Emacs 19
+** Differences between XEmacs and GNU Emacs 19
 ==================================================
 In XEmacs 20, characters are first-class objects.  Characters can be
 converted to integers, but are not integers.  FSF 19, XEmacs 19, and Mule
 In XEmacs, keymaps are first-class opaque objects.  FSF 19 represents them as
 complicated combinations of association lists and vectors.  If you use the
 advertised functional interface to manipulation of keymaps, the same code
-will work in XEmacs, Emacs 18, and FSF GNU Emacs 19; if your code depends
+will work in XEmacs, Emacs 18, and GNU Emacs 19; if your code depends
 on the underlying implementation of keymaps, it will not.
 
 XEmacs uses "extents" to represent all non-textual aspects of buffers;
 -- The `face' property of extents and text properties can now
    be a list.
 
--- The `mouse-face' property from FSF GNU Emacs is now supported.
+-- The `mouse-face' property from GNU Emacs is now supported.
    It supersedes the `highlight' property.
 
--- `enriched' and `facemenu' packages from FSF GNU Emacs have been ported.
+-- `enriched' and `facemenu' packages from GNU Emacs have been ported.
 
 -- New functions for easier creation of dialog boxes:
    `get-dialog-box-response', `message-box', and `message-or-box'.
 *** Keymaps
 -----------
 
-The FSF GNU Emacs concept of `function-key-map' is now partially
+The GNU Emacs concept of `function-key-map' is now partially
 implemented.  This allows conversion of function-key escape sequences
 such as `ESC [ 1 1 ~' into an equivalent human-readable keysym such as
 `F1'.  This work will be completed in 19.14.  The function-key map is
 can now easily specify an action to be invoked on single-click
 (i.e. down-up without appreciable motion), double-click, drag-up, etc.
 
-Some code from FSF GNU Emacs has been ported over, generalizing some of
+Some code from GNU Emacs has been ported over, generalizing some of
 the X-specific mouse stuff.
 
 ** INCOMPATIBLE CHANGE **: The function `set-mouse-position' accepts

Binary file added.

Binary file added.

     )
   )
 
+;;; ********************
+;;; Load the default-dir.el package which installs fancy handling
+;;;  of the initial contents in the minibuffer when reading
+;;; file names.
+
+(if (and running-xemacs
+	 (or (and (= emacs-major-version 20) (>= emacs-minor-version 1))
+	     (and (= emacs-major-version 19) (>= emacs-minor-version 15))))
+    (require 'default-dir))
 
 ;;; ********************
 ;;; Load the auto-save.el package, which lets you put all of your autosave
 PUBLIC "-//Microsoft//DTD Internet Explorer 3.0 Tables//EN"     ie3tables.dtd
 PUBLIC "-//Microsoft//DTD Internet Explorer 3.0 HTML//EN"       ie30.dtd
 PUBLIC "+//Silmaril//DTD HTML Pro v0r11 19970101//EN"	htmlpro.dtd
-DOCTYPE HTML						html.dtd
+DOCTYPE HTML						html-3.2f.dtd
 DOCTYPE HTML-3						html-3.dtd

etc/w3/stylesheet

 
        p  { display: block }
  pre,xmp  { display: block; white-space: pre; }
-blockquote{ display: block; margin-left: 5; margin-right: 5; }
+blockquote{ display: block; margin-left: 5em; margin-right: 5em; }
 
 /*
 ** How to draw form elements.
       dir { display: block;     }
      menu { display: block;     }
        dt { font-weight: bold; display: list-item }
-       dd { display: list-item; margin-left: 5; }
-       li { display: list-item; margin-left: 5; }
+       dd { display: list-item; margin-left: 5em; }
+       li { display: list-item; margin-left: 5em; }
     ul li { list-style: circle; }
     ol li { list-style: decimal; }
 
Add a comment to this file

etc/xemacs-white.xpm

Removed
Old image
-/* XPM */
-static char *noname[] = {
-/* width height ncolors chars_per_pixel */
-"388 145 25 1",
-/* colors */
-"` c #787879",
-"a c #686869",
-"b c #A6AAF5",
-"c c #585859",
-"d c #484849",
-"e c #09090B",
-"f c #5256D7",
-"g c #989CEA",
-"h c #363ACC",
-"i c #C7C8CF",
-"j c #282829",
-"k c #FFFFFF",
-"l c #13154C",
-"m c #7074DF",
-"n c #D9D9DB",
-"o c #232788",
-"p c #383838",
-"q c #4249D0",
-"r c #B6BAF9",
-"s c #868AEB",
-"t c #A8A8A9",
-"u c #989899",
-"v c #6266DB",
-"w c #888889",
-"x c #B9B9B9",
-/* pixels */
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkknkkkkkkknkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkknikkkknninkkkkkkkkkkknninnnkkkkkkkkkinkkikkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkknknkkkkkkkkkknkkkkkkkknkkkkkknkkkkknkknkkkkkkkkkkkxkkkkkkknkkkkkkknkkkknknkkkkkkknkkkkknknnkkkkkkkkknkkknkkkkknkkkkkkkkkkkkknkkkkkkkkkkkkknkkkkkkkknkkkkkknkkkkknkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkknnkknnnnikkkkkkkkkknnnnkkknnnnnkkkinnikkkkkinnkkkkkkkkkkikkkkkkknkkkkkkknnkkkkkkkkkkkinnnnkkknnnkkkkkkkkkknnninnkknnnnnkkknnninkkinnnnkkkkkkkkkkinnnkkknnnnnkknnnnnkkknkxnkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkknkkknkkniiiinkknkkknkknkkknkknkkkknkknxkkkkkkkkkkkkkkkkkkkkknkkkkkkiinnkkkknkkkknnnnnxkkkkxkkkkniiiinknnknknkknkkkkkknkkkknknnnnnikkiiiiikkknkknkknkkkknkknkkkknkknikkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkknkkkkkkkkkknkkknkknkkkknknkkkknkknnikkkkkkkkkkkkkkkkkkkknkknkkikkknkkkknkkkknnnknnkkkxkikkkkkkkkkknnknknkknkkkknknkkkknkinnnnnkkkkkkkkkknkknkknkkkknkknkkkknkkinnkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkknnkknkkkxkkkkkkkkkknkkknkkinkkikknnkknnkknkkikkkkkkkkkkkkkkkkkkknkknkkikknnkkkknkkkkkxkkkkkkikkkikkkkkkkkknnknknkknnknxkknnkkinkkxkkkkkkkkkkkkkknkknkkkikknikkinkkikkknknnkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkknkknkkninnikkkkkkkknxkkixkkkixxnkkknxxnkkiikkxxkkkkkkkkkkkkkkkknxxxxxkknxxkxnkkixxnkkkkxxikknxiknxnkkkkkkknxikxknnkkixikkkknxikxnkkixikkkkkkkkkkixkkxxkkkixnkkkkixxkkkxnknxikkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkknkkknkkkkkkkkknknkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkknkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkknkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkknkkkkkkkkkkknkkkkkknkkkkkkkkkkkknkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkknkkkkkkkkknkknkkkkkkkkkkkkknkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkknkkkkkkkkkkknkknkkkkkkkkkkkkknkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkknknkkkkkkkkkkkknkkkkkkkkkknkknkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkknkkkkkkkkkknkkkkkkkkkknkknkkkkkkkkkkknkkkkkkkkkkkkkkknkkkkkkkkknkkkknkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkknkkkkkkkkkkkkkknkkkkkkkkkkkknkkkkkkkkkkkkknkkkkkkkkkkkkkknkkkkkkkkknkkkknkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkknknkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkknknknkkkkknkknkkkkkkkkkkkkkknkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkknknkkkkkknkknkkkkkkkkkkkkkknknknkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkknkkkkknkknkkkkkkkknkkkkkkkkkkkkkkkkknkkkknkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkknknkkknkkkkkkknknknkkkkknkknkknkknkknkkkkkkkknkkkkkkkkkkkkkkkkknkkkkkkkknknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkknkkkkknkkknkknkkkkkkkknknknkkkkkkkknkkkkknkknkkkkkkkknkkkkkkkkkkkkkkkkknkkkkkkkknknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkknkknknknkknkkkkkkkkkkkkkkkkkkkkkknkkkknkkkknkknuunnkknkkkknkkknkkkkntkkkkkkkkkkiikkkkkkknkkkkkknkkkknnkkkknnkkknkkkkkkkkkkkkkkkknkknkknkkknknkkkknkkkkkkkkkkkkkkknkknkknkkkkkkknkknkknknkknknkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkknkkkkkkkkkkkknkkkkkkkkkkkkkkkkknkknknkkkknkkkkkknkkkkkkkkkkkkkkknkknkknkkkkkkknkknkknknkknknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkknkknkkkknkkkknkkkkkkkkkkkknkkkkkkkkkknktnkkkkiknkkkknkkkkkkkkkkkkikkkkkkkkkkkinkkknkkkkknkkkknknkkukkkktkknkknkkkkkkknknkknkkkknknknknkkkkkkkkkkkkkkkkkkkknkkkkkkkkkknkknkkkknkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkknkknkkkknkkknknkkknknknkkkkkknknknkknkkkknkknknkknkkkkkkkkkkkkkkkkknkkkkkkkkkknkknkkkknkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkknkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkknknkkkkkknknkkkkkkkknkknkkknkkkkkknkkkkkkkkktkkkknikkknnkixnknininnnkkxkninkkkkiikikknniikkkkknkkkkkkkxnknkkiikkknknkkkkkkknkkkknkknkkkkkknknknkkkkknkknkkknkkkkkknkkkkkkkkkkkkkkkknkknkknkkknkkknkkkkkkkkkkkkkkkkkkkkkknkkkkknkknkkkknkkkkknkkkkknkkkkkkkknkkknkknknkkkkknkknkkkkkknkknkkknkkkkkknkkkkkkkkkkkkkkkknkknkknkkknkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkknkknnknkkknnkkkkkkknkkkkkkkkknkkknkkkkkkknnknkkkxnkkkknixtkkxuxuxxikitxiukkktiiuxkknixxikkkkknkkknkktkkkkkktkkkkkkkkkkknkkknknkkkknknknkkknkkkkkkkknkkkkkkkkknkkknkkkkkkkkkknknknkkknkkknkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkknkknkkkkkknkkkkknkknkknknnkkknkkkkkkkknkkkkkkkkknkkknkkkkkkkkkknknknkkknkkknkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkknkkkkkkkkkkkknkkkkkkkkknknkknkkknkkknknkknknkkkxkkkkkkxknknkiuuukknukxkkxkxnkkktkikkkkxkkktutikknkkknknkkkxknknkkxnknkknknkkkkknkkkknknkkkkknkkkkkkkkkknknkknkkknkkknknkknknkkkkkkkkkkknnkkknkkknkkknkkknkkkkkkkkkkkkkkkkkkkkkkknkknkknkkknknknknkkkkkkknkkkkkknnkkkkkkkknkkknkkkkkkkkknknkknkkknkkknknkknknkkkkkkkkkkknnkkknkkknkkknkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknkkkkkkkknkkkkkkkkknknkkkkkxkkkknkxknkkntnktnkkwkxkkxkxkkkkxkxkkkkxkkxnknxkkkkkkkkknkkxnkkkkkxkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknkkkkkkkkknkkkkkkkknkkkkkknkkkkknkkknknkkknkkknkkkkkkknkkkkkkkkkkkkkkkknkkkkkkkkkkknkkknkkkkknkknkkkknkkkkkkkkkknkkkkkkkkkkkkknknkkkkkkkkknkkkkkkkknkkkkkknkkkkknkkknknkkknkkknkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkknnknnkxknkknxkknkxkkkwknkwkxkkxkxunkxnkntkkttkktkkixkkkknkkkknkktkknknnxkknkknknknkkkkkknkkkknknkkkkkkkkkknkkkkkkkkkkkkkkkkkkkknknkknkknkkknkkkkkkkkkknkkkknknkkkknkkkkkkkkkkkkkkkkkkkknkknkknknkkknkkkkkkkkknkknkkkkkkknkkknkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkknknkknkknkkknkkkkkkkkkknkkkknknkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknkkkkunkkxwwwwikkuwunwkwwktikwnwnwwnkkknwwittkiwwnwnnkkkknkkkkkntkkkktnnkknkkkknknknnnnnnnnnnnnnkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknnkkkkkknkknnkknkkknkknknkkkknkkkkkkkkkkknknkkkkkknkkkkkkkkkkkknkknknnnknknkkknknknknnkkknknknknkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknnkkkkkknkknnkknkkknkknknkkkknkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkrrrrrrrrrbrrrrrrbrrrrrrrrrrrrrikinnkkknirrrrrrrrbrbrbrrbrrriknkkkkkkrrrrrrrrrrrrrrbrrrbrbrrrrbrrrrrrrrrrrrrrrrrrssssssgsggbkkkkkkknkkkkkkkkkknknkknkkkkkknkkkkkkknkkkkknknkkkkkkkkknknkkknknknkkkkkkkkknkkknkknknknknknkkknknkkkknknkknkknknkknkknknkkkkkkkkkkkkkknkkkkkkkkkknknkknkkkkkknkkkkkkknkkkkknknkkkkkkkkknknkkknknknkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkrhhhqhhhhhhhhhhhhhhhhhhhhhhhhhhmkkknkkkivhhhhhhhhhhhhhhhhhhhmknknkkkrhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhtnknkkkknnkkkkkkkkkkkkknkkkkkkknkkknkkknknkkkkknknkkkkkkknnnkknkkkknknkkkknkknkkkkkkkkkkkkkknkkknknnkknknkkknkknknkkkkkkkkkkknknnkknkkkknnkkkkkkkkkkkkknkkkkkkknkkknkkknknkkkkknknkkkkkkknnnkkknkkknknkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkknknknkkihhhhhhhhhhhhhhhhhhhhhhhhhhhhhhodknkkkknvhhhhhhhhhhhhhhhhhhhockkkkkkihhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhoenkkknnkkkkknkknknkknkknknnknkkkkkkkkkknkknkknkkkkknknkkkkkknkknknkkkkkkkkkkkkknnkknknknnkknknknkkkknkknknkkkkknkknnnkknnkkknkknknkkknnkkkkknkknkkknknkknnnkkkkkkkkkkkknkknkknkkkkknknkkkkkknkkkknkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkknkkknkkmohhhhhhhhhhhhhhhhhhhhhhhhhoooldkknknkkbhohhhhhhhhhhhhhhhholdnknnkkkmohhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhlcnknknkkkkknkkkkkkknknknknkkkkkkknkknnkkkknkkkknnkkkkkkknknkknkkkkknknnkkkkknkkknnkkkkkknknkknknknknknknknknknkknkkknkkkknnkknknknknknkkkkknkkkkknknkknkkknknkkkknkknnkkkknkkkknnkkkkkkknknknnknkkknknnkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkknkknkkkdpllhhhhhhhhhhhhhhhhhhholeepddwnkknknkkwdddqhhhhhhhhhhooeepwknkkknkkddjeoqhhhhhhhhhhhhhhhhhhleeeeeeelloohhhhhhhhhhhhhhhhl`nnnnknknknknnknknkknkkkkkknkknkkkkkkknknkkkkkkknnnknknkkknnkkknnnkkkkkkknkkkknkkknkkkkkkkknknkkknkkkknkkknkkknknkknnknkkkkkkkknknknkkknknknknknkkkknkkkkkkkkknkkkkkkknknkkkkkkknnnknknkkknkkkknknkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkknkx`fhhhhhhhhhhhhhhhhledtnnknnnnnnnnnkkkknshhhhhhhhhlej`nnnnniknknkkkkknghhhhhhhhhhhhhhhhoel`xnninitwudplohhhhhhhhhhhhheunnnnnnnknknkknkknnnkkknknkkkkkkkkkknkknkknnnkkkkkkkkkkkkkkkknkkkknnknkkkkkkkkkkkkknkkknkkkkkknnkkkknkkknknnnkkkkkkkkknkkknknkkkkkkknkkknknknknknnnnknknnknkkkkkkkkknkknkknnnkkkkkkkkkkkkknknkkknknnknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknnmhhhhhhhhhhhhhhhlcxxiixixxxxiinnnkkkighhhhhhhheeaxxxxxxxiiinnknkknnivhhhhhhhhhhhhhhhejxxixxxxxxxxxii`dohhhhhhhhhhoetxtxxinnnnknknknknknnnknkknknkkkknkkkknknnkkkkkkkknkkknkknknknknknkknknknnkkkkknkkkknkkknnknknkkknkkkknknkkknknknknkkkknkkkkkknknkkkkkkkkknknknkknknnknkkknknkkknkkkkknknnkkkkkkkknkkknkknkknknkkkkknkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkknkkkkknkkkkkkkkkkkkknirfhhhhhhhhhhhhhhecuuwwuuuuuuutxnnnkkrvhhhhhhoeewuwwwuuuuutxxnnknkknrvhhhhhhhhhhhhhhoewwuwuuuwuuwuwuuuuwdqhhhhhhhhoew`wwwuxnnnkknkkknknknknknkkkkknnkknkkkknknnknnknkkkkknkkkkkkkknknkkkkkkkkknknkkkknkkkkkkknkknkknkkknknkkknnknnnkknkkkknknkkknkkkkknkkkkknkkkknkkknkknnknnkkkkknkknknkkknknnknnknkkkkknkkkkkkkkknnnkkknkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkknknitshhhhhhhhhhhhhhlcccccaaaa``wuxinnkrbhhhhhhoejdccaacacaaa`utxnnkknnrvhhhhhhhhhhhhhhllccaccaaaaaaaaaaaaaaaqhhhhhhhljcdcca`txnkkkkkkknknkkkkkknnnknkknnnknkkkkkkkknkkknnkkknkknknkkkkkknkknnkkkknkknkkkkkkkkkkknkknknnknkknknkknkknknknknkknknkkkknknkkkkkkkkkkkkkkknknnkkkkkknnnknkknnnkkkkkkkkkknkkknnkkknkknknknkkkkkkkknkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkniughhhhhhhhhhhhhhljjpjpppdcaa`utxnnirfhhhhhoeejjpjpjpppddcaaccxnkkinrhhhhhhhhhhhhhhhejjpjppppjpccaccccccddvqhhhhhheejjjjpawxinkkkknkkknknnnnnkknknknkknknnkknkknknknnkknkkkkknkknknkkkkkkuukknkkkkknkkkkkkkknkkknnkkkknkkknknknknkknknknkkkkknkkkkkknknnkkkkknkkkknkkkknknnnkknknknnknknnnkknkknknknnkknkkkkknkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknnituvhhhhhhhhhhhhhoeeejejpdca`wuxinnrmhhhhhoelpjejejejjjdda`ctnkkkkxnrhhhhhhhhhhhhhhoeeeeejejpdpcaaa`aaaccddmhhhhhheeeeejpc`cdannknknkknknxa`cackknknnnnkccnkcaknkkknknkkkknkkknknkkkkkkkkktkkkkkkkkknkkkkkkkkkknkkkknkknkkkkkknknknknkkkknknknkknkkkkkkkkkkkkkknknknknknknknkkkknknknnknknnkkkknkkknknkkkkkkkknknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkniitshhhhhhhhhhhhhheeeejjpc`wutxinnrshhhhhoejcdpeeeeeejpc`aaautnnkttishhhhhhhhhhhhhhleeeeeeljpccwaa`uwwacaacsqhhhhoeeeeeejcwxunknkkkittkkktkntktnknxtinknndknwnkkkknknktitniikkkntxkkkkkxxkxkkkitxkkkknknkknxxxkxnnnkitxknntkttnknknknknnkkknkknkkknknkkkkkkknknkkkkknkkknknknnkknknnknknnknknnkkknkknnkkkknkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknknnirhhhhhhhhhhhhhheeeeepc`utxxinnighhhhhoepcapjeeeeejjp`wwwatxkknt`rmhhhhhhhhhhhhhhleeeeeejpc`ata`uxxca`ccwwmhhhhleeeeejpawxunkknkktttwnnkkktkkkn`uuu`nknn`cknnnkkkkkkt`xaxuikn`xx`nkk`ttaukk`uxw`nkkkkkkknwuu`xwknntxuiki``ut`xkknkknknnnknkkkkknkkkkkkkknkkkknnkknkknnkkkkkknknnknnnnknknnknnkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkknknnknivhhhhhhhhhhhhhleeejpauxinnnnrbqhhhhoedwiwapjeeejjdjtxinunnnkkktrfhhhhhhhhhhhhhheeeeeeeejwuwctnnni`uuwcutshhhheeeeeejpauxuknnknkua`uknnkktnknn`ttuaxknn`wknkxaaacakkckxkkxkxkkkktktnkkkwki`ttxaxnwaaa`tkttntktkkn`autkktnknkwkknknkkkkkkknknkknkkkkkkkknnnknkknkknknknnkknkknkknknknnnnknknnkkknnkkknkkkkkkkkkkkkkknkkkkkknkkknkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkknkkkkkkkkkkknknknkknknknshhhhhhhhhhhhhoeeejd`uinnkkrrqhhhhhednuxucpejejpda`xinntnkknnkxrhhhhhhhhhhhhhhoeeeeeejpaux`x`nnnx`ttuuiighhhheleeeejp`tiunkntktxnnwkknkntknkx`ttttnnkwxttkkkkkkkkknaktkktktkkkktktknnktkx`ttttnkknkkkkkxxkuntnkunkntkkunknkwnkkknkknknnknknknknkknnknkkknknnnknknnkknknknknknnnknkkkknkkkkkknkkkkknkkkkkkkkkkkkkkkkknkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkknknkkkkkknknknknkbhhhhhhhhhhhhhheeejd`tinknrbqhhhhoejnnu`wdjejjjauxxnnnkuknkknnbshhhhhhhhhhhhhhleeeeeejc`titni`knkcxkniknrhhhoepjeeejd`titnknukwkkn`nknkktkknncxkknkktxnkcnknkkknkkkaktkktkitkkuxkn`knw`nkaxnnnnkkkkkkkktxntntnnukktxkkx`nkuinnnknknknkkkknnkkkknnkkknnknknkknkkkkkknknkkkkknknkkkkkkkknnknkkkkkkkkkkkkkkkkkkkknkknkkknnkknkknkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkknknknnknknkkknnnfhhhhhhhhhhhhhleejd`tnkkibqhhhhheeinnxajjjepdadd`xknwcccwkntarmhhhhhhhhhhhhhheeeeeeepcwx`unkcanknwcwxknrhhhoecpeeepcwwccccaxkicctuwkntcccnnknwa`xkkaakkackkknkknnaakuikakkiacxknknacxwwnnua`xnknkkkkkiawkanxwkuccicxktn`ciknkknknknknknkkkkknkknnnknnknnnnnkknnnkknknknknnnknnknknkkkkkkkkknknknnkkkkkkkkkkkkkkkkknknknkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkknkkknnknkknmhhhhhhhhhhhhhoeejpauxnirfhhhhoeltxnit`cpjpd`utnnkknnnknknkknrqhhhhhhhhhhhhhoeeeeeejpauxknkknnknknknnkkrhhhld`djjjpcwxnnknknnknknknkknkkknkknnnnnkknknkkkknkknkkknkkkkkkkkkkkkkkkkknnnkkknkknkkkkkkkkkkkkkknnnkkkknnktkkknkknnnknnkknkknkknkknkkknkknnkkkknnnnknnnknknkknknknnnknkkkknkkkknkkkkkknkkkkkkkkkkkknkkkkknkknknkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkknkkkkkkknknknnknkknknknbhhhhhhhhhhhhhheeepcuxirvhhhhheliknxtwcpppcawxinknknknnknknknbhhhhhhhhhhhhhhoeeeeeejp`unkkkkkknknknknknghhhe`wcpjjpattnnnnnkknknknknnknkknnkknkkknkkkkkkkknknkknkkknkkkkkkkinknknkknknnnknkknknkkkkkkkkkkknkknknnkknxpctkkkkkkknkknnknnkknnkknknknnnknnnnnkkkkknknkknknkknnkknknknnkkkkkkknknnknkknkkkkkkkknnknkknknknknkkknkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkknkkkknnkkkkkkkknknknnkkkkkiqhhhhhhhhhhhhhleejcwrrvhhhhheennnitwadppc`utxnnnkkknknnknnkrshhhhhhhhhhhhhhleeeeeejdwuxinkknnnnknnknnnnmohetuapjjd`xxnnknnknkknknknknnnkknknknknknnkknknnkknnknknkkkkknkkkknnnknkknnknnknnknkknkkknnknkkkkknnnknknknknnnkkkkkkknnnknnnnnknnnkknkknkknnnnnnnnnkknknnnknnkknknkknkknnkkknnnknknkknkkkkkkkkkkkknknkkkknknkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkknkkkkkkkkknkknkkkknknkkknnnknmhhhhhhhhhhhhhoeejdtrvhhhhhelnnnitwadppd`uxnnnknnnnknnnknkkrvhhhhhhhhhhhhhheeeeeeepcwxinnknrgvbrknnnnknncjlit`dppcwxnnnnknknnnknkknkknknknknnnnkkkknnnnkknnkkknkkknkkknkkkknnnnnnknknnnnknkkkkknknkkkkkkkkkkkknnkknnnnnnnknkkkkkknnnknnkkknknnknnkkkknknkkkknnknkkkknkknnnnninnkkkkknkkkknknknkknkknkknkkkknnnnknkkkknnkknnnkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknkkkkknghhhhhhhhhhhhhheeesrvhhhhoeeinnxtwadppcawtikkkkkkknkknnknknrhhhhhhhhhhhhhhoeeeeeejp`uxnnnnnrqhhwxknnknnkkkkixwapdauinnknknkkknknnniirnikkknkknnniirrggsgikknnnknnkknkkknirrrgsggnnknkknknkkkkkknkkkknkkkkkkknknknirrbsssbnnnnkkkknnnnniiiikkkkkkkkkkknnknnnkknknnnnnnirrrsssggrnnnkkknkkknknnknknnkknkknrrrbsgsgrnnnkkkknrsgrkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknnkkknnknnhhhhhhhhhhhhhhlewrvhhhhhelinnitwadppdawtinkkkknkkknkknknknghhhhhhhhhhhhhhoeeeeeejd`tiinknrshhhetkkkkkkkkknnxwcdd`uiknknnnnniiirrrssvqsikkkkknkrrgvhhhhhhminknknknknnknrbmqhhhhhhmiknknknknnnknkkknnknkkkkkkkkirrsvhhhhhhqgkknnrrrgssgssvmsnknkkknkkkknnnkkkknknknirbsmqhhhhhhhfsrkkkknkkknknnnkknknnnrbmfhhhhhhhfsrnnknrghhhtkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknkkkkknnfhhhhhhhhhhhhhoprvhhhhheennnxtwaddpdawxiinkkkkkknknknkknnrmhhhhhhhhhhhhhheeeeeeejcwxinnkirqhhoekkkkkkkkkkknxuaccwxrrrrrrssssvvfhhhhhhlankkkkirgqhhhhhhhhhqxnnknknkknrbmhhhhhhhhhhhgknkknnkkknknnkkkknkkkkkknrrsqhhhhhhhhhhfnkrshhhhhhhhhhdakknkkknkkkknnnknkkknrrgvhhhhhhhhhhhhhhmnknknnknknknnnkknrbmhhhhhhhhhhhhqvsbrgqhhoekkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknnknknghhhhhhhhhhhhhhrshhhhhelinnitwacppdawxinnnnkkkkkkkkkkknkkrfhhhhhhhhhhhhhheeeeeejpcuxinnirmhhhopkkkkkkkkkkknit`aaugvfhhhhhqhhhhhhhhhhhetnnknrrvhhhhhhhhhhhhhinnnknnnrsqhhhhhhhhhhhhhwknkknknknkknknknkknkkkirsqhhhhhhhhhhhhhdnrfhhhhhhhhhhlakkkknkkknkkkknnnnnirgfhhhhhhhhhhhhhhhhhfnnkkknknnknknknrsqhhhhhhhhhhhhhhhhhhhhhhodkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknkkrhhhhhhhhhhhhhhshhhhheeinnituadppdawtinkknwctkkkkkkxkkkknrhhhhhhhhhhhhhhoeeeeeejp`uinnnrghhhhlankni`dxkknknixw`wxshhhhhhhhhhhhhhhhhhljnnnnibqhhhhhhhhhhhhhqonntnnirshhhhhhhhhhhhhhhhwcxnknknknknkkkknkknkrbvhhhhhhhhhhhhhhqhurhhhhhhhhhhhexkknxcwkkkkkkkkkknrbmhhhhhhholeedqhhhhhhhqnnnnknknnnnnnrshhhhhhhholeeelhhhhhhhhhhlckkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknnknnvhhhhhhhhhhhhhhhhhhlexnnixwacdpda`uxnnkkkukknkkkkiwknkkrghhhhhhhhhhhhhhleeeeeejdwxinnrrqhhhhexkniiiiwnkkknnxtutxghhhhhhhhhhhhhhhhhheanknrrqhhhhhhhhhhhhhhho`i`iirvhhhhhhhhhhhhhhhhhlpnknnwdpaknnknkknknrbqhhhhhhhhhoeeehhhhvshhhhhhhhhhoennknnkukkkkkkkknnrsqhhhhhhhlepuxnshhhhhhhhonknnknnknknrgqhhhhhhhledunkiwfhhhhhhhhlwnknnknkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknknnmhhhhhhhhhhhhhhhhhlecxiitu`ddpdawtxnnkkkkunkknkkk`kkkkkrvhhhhhhhhhhhhhheeeeeeejpwtnxrbqhhhhoeuinxttt`nnnkknnxxixrcllhhhhhhhhhhhhhhhetiurbqhhhhhhhhhhhhhhhhhjtxwrshhhhhhhhhhhhhhhhhhoaxinnnkuknknknxtxnrshhhhhhhhhheecxxumhhvvhhhhhhhhhhljtxiiinwknknnkttirshhhhhhhhledtnirmhhhhhhhhhpxnnitiutnnrqhhhhhhhoewnniituxvhhhhhhheuniixxinknknkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknkknkkkkkkkkknkkrhhhhhhhhhhhhhhhhlepwtttu`cpddawuxiinnkkktknkknnkwkkkk`rqhhhhhhhhhhhhhheeeeeeejduxrrsqhhhhhlpudtuw`wainnknknnninxwccashhhhhhhhhhhhoextrbqhhhhhhhhhhhhhhhhhhewurshhhhhhhhhhhhhhhhhhhodttxnnnunknknnuturshhhhhhhhhheedwxtuwfhqhhhhhhhhhhhedacxtttwinnkndubrvhhhhhhhhledw`crbqhhhhhhhhhld`xxaauuwrshhhhhhhhepuiitu`c``qhhhhhhexix`wuuinnininnkkknkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknnkknkkkkkkniqhhhhhhhhhhhhhhlejd`wuwacdpdawtxinnnnknktknnkknkunnnxibhhhhhhhhhhhhhhoeeeepdcwtrrgfhhhhhhhl`iiaw`awainnnkkkknknknwnnrhhhhhhhhhhhhljubbqhhhoelvhhhhhhhhhhhhecrghhhhoeeqhhhhhhhhhhhhojawutxnuknknkna`rghhhhhhhhhoee``ju```shhhhhhhhhhhhoew`awwwuainnnunirvhhhhhhhhoedwwwprmhhhhhhhhhhopjtxwnnntrqhhhhhhhhetwuww`adccshhhhhoeutu``wttnkikkkkkknkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkknkkkkkknkknkknknknkkkkknshhhhhhhhhhhhhoeeedc``adppda`txinnnkkkkntkknnknnunknuishhhhhhhhhhhhhhsrbrrrsssmvhhhhhhhhhhetitaacc``innknknkkknnnukkrhhhhhhhhhhhhedgrfhhhlectbhhhhhhhhhhhoegbqhhheecitmhhhhhhhhhhhoepcautiwnkunkwirshhhhhhhhhhleaaadacpdshhhhhhhhhhhhlecddccawaxnnntirvhhhhhhhhhedc`aa`rhhhhhhhhhhhoep`u`xnntghhhhhhhhhex``ccdppddwfhhhhoea``ccawunniknkkkknknkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkknkkknkknkkghhhhhhhhhhhhhheeejpccddddawuxinnnnnnkkkukkknnknwnnnnrfhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhoeitcccda``inknknknkkkkkunirhhhhhhhhhhhoecrvhhoeecxirhhhhhhhhhhhocrfhhheexnnbshhhhhhhhhhhlejjdauxwnkuknwrshhhhhhhhhhoejw`adpjlashhhhhhhhhhhhejjjejjd`axnnnrrvhhhhhhhhheexp`wa`shhhhhhhhhhhoepdaaxnnbshhhhhhhhhewdcpjjjjdcamhhhhoedddpdcwunkxkkkkkknkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkknkknknnkkkknkrqhhhhhhhhhhhhhleejjppppdcwtxnknkknkkkkkukkknknnwiknkrhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhlpdjacdpjjpd`kknnnkkkkwcddgshhhhhhhhhhhlershhheedpxtbhhhhhhhhhhhorshhheeuinnrmhhhhhhhhhhhleeejdppddddnkrbqhhhhhhhhhhed`pjejjeewshhhhhhhhhhhheeeeejjejppdnnrvhhhhhhhhhoeutwpjlcshhhhhhhhhhhoejjpjdxtgvhhhhhhhhhljjejljjjpp`ghhhhlepjjejcawnxxknkknkkknkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkknknkknnnkkknnmhhhhhhhhhhhhhoeeeejjjdc`txnnnnnnnnnkkkwunkkkknk`nnrghhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhewuwcdpdauxnnnnkknknnkkkkkimhhhhhhhhhhhegbhhheedwtirshhhhhhhhhhhsghhoeeauxxwrfhhhhhhhhhhheeeejpcwxnnnnirqhhhhhhhhhhlewadjjjeljsvhhhhhhhhhhhleeeeeejdatikkrshhhhhhhhhhepu`adpjpshhhhhhhhhhheeejpc`tirvhhhhhhhhhhjjjeejdawttrfhhhljjjejpdwxnkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkknkkknkkkkghhhhhhhhhhhhhheeeejjpcwuxinknkknknkkkkxuinkknknnnkrmhhhhhhhhhhhhhhlelllloohhhhhhhhhhhhoewwcpjjdatxnkkkkknkkknknkkrvhhhhhhhhhhodrfhheejcwtxrmhhhhhhhhhhhrqhhlejawxtubhhhhhhhhhhhheeeeejd`tnkknrvhhhhhhhhhhoeccdjeeejjpbvhhhhhhhhhhhleeeeeejc`tinrbhhhhhhhhhhoeu`cpjjljahhhhhhhhhhoeeeeepawxivhhhhhhhhhhoeeejpawtxiimhhhejjeeepcwxnkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknknkknkkkrqhhhhhhhhhhhhhleeejjc`uxnnnknnnnkkkknnnknnkkkknknnrfhhhhhhhhhhhhhheeeeeeeelllhhhhhhhhhol`cpjjjd`tiknnnkkknknknkknrhhhhhhhhhhhorshhlelpauxxrfhhhhhhhhhhmmhhleepcwtxrmhhhhhhhhhhhoeeeeejd`txnnrshhhhhhhhhhhejcpjjeeejpcrqhhhhhhhhhhheeeeeejjcwxnirqhhhhhhhhhhep`cpjeejpdvhhhhhhhhheeeeejjcwtrvhhhhhhhhhhqeeejd`tinnnshhheadjejpcuxnkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkknkkkknkknkkkkkrvhhhhhhhhhhhhhoeeejpauxinnnnkkkknkkkknnnnknkknnnknrhhhhhhhhhhhhhhoeeeeeeepc`uaqhhhhhhhljdpjljjcwxnnkknknkkkkkknnnshhhhhhhhhhhbghhoeejd`uxtbhhhhhhhhhhhshhoeeepcwutrfhhhhhhhhhhhleeeeejpatxnnbqhhhhhhhhhhoedpjeeeejpcurhhhhhhhhhhhoeeeeeeedauinrmhhhhhhhhhhoecdpjejejd`ufhhhhhhhleeeeeejd`tifhhhhhhhhhhhheejcwtinkkkhhoe`cjjepauinkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkknnknknibqhhhhhhhhhhhhhheeejc`tinkkkkkkkkkkknnknknnnnkkknnishhhhhhhhhhhhhhleeeeeeejdawwuvhhhhhhejpeeelpcwxnnknkkknknknknkrmhhhhhhhhhhqrhhheeepcwutrshhhhhhhhhhfqhheeejpawugbhhhhhhhhhhhheeeeeejd`uinrmhhhhhhhhhhhlepjeeeejjd`bshhhhhhhhhhhleeeeeejdwtirbhhhhhhhhhhhlecjjeeejpawxicooooleeeeeeeejd`tishhhhhhhhhhhhpejdwxnnnnkneejwapjjd`tinkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkknkkkkknkkkkkkkkkknknnknkkkkknkkirvhhhhhhhhhhhhhhhleejdwxnnkknkknnkknnnnkknnknknkkkkrvhhhhhhhhhhhhhheeeeeeeejpdaaashhhhhoeeeeeejpauinknknkkknkkkkknrfhhhhhhhhhhmmhhleejdauturvhhhhhhhhhhqhhoeeeepd``tshhhhhhhhhhhheeeeeejp`tirghhhhhhhhhhhoejjeeeeejdauxmhhhhhhhhhhheeeeeeepcwxnrfhhhhhhhhhhhepjleeejpcwxnkkncppleeeeeeeejdwtibhhhhhhhhhhhhhjjd`xnkkkkknnit`dpjd`tnnkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknkkkkkkrrvhhhhhhhhhhhhhhhhleejd`tnnkkknnknnkkknnkknnnnnnkkkkrqhhhhhhhhhhhhhoeeeeeeejjpdddc`vhhhhleeeeeejd`tnnnkkkknkknknkknrhhhhhhhhhhhshhoeeejdawwwrhhhhhhhhhhhhhoeeeejpda`rfhhhhhhhhhhhleeeeeejdwtirfhhhhhhhhhhhlejeeeeejpawxrvhhhhhhhhhhoeeeeeeepauxrghhhhhhhhhhhlejjeeeejd`uxinnnntwcpeeeeeeejdwxnrhhhhhhhhhhhhhhjp`unnknkknknxucppcwtnnkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkknkkkknkkkkkkknknkkkkirvhhhhhhhhhhhhhhhhhheejp`uinknkknnknnnkknkkknknknnnknbhhhhhhhhhhhhhhoeeeeeeejpdcccc`mhhhhleeeeeepcwtiknknknnkkknkknnshhhhhhhhhhffhheeeepdaw`gghhhhhhhhhhhhhleeeejjdcwbhhhhhhhhhhhhleeeeeepcwxrghhhhhhhhhhhoeleeeeeepc`xxrhhhhhhhhhhhleeeeeejd`tirfhhhhhhhhhhhlejeeeeepcwtinnkinxwcpjeeeeejpawxnnmhhhhhhhhhhhhhhjcwxnkknkknniu`ddcuxnkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkknknkknkkknrvhhhhhhhhhhhhhhhhhhheeepcuinnnkkntknnnknnkkknnknnkknimhhhhhhhhhhhhhhleeeeeeeejcwwwaushhhoeeeeeejepwxnnnknknknnknkkkrvhhhhhhhhhhqhhleeeepca``bmhhhhhhhhhhhhoeeeeejppdbmhhhhhhhhhhhoeeeeeeejawxrfhhhhhhhhhhhleeeeeeejpauxrghhhhhhhhhhheeeeeeejdwtrghhhhhhhhhhhhejeeeeejdauinnknnixuadjeeeejjd`uinkrhhhhhhhhhhhhhhqd`uinkkkkkkitwac`uinnkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkknnknnrshhhhhdfhhhhhhhhhhhhhoeejc`xnnknkainnnnnkkikkkknkknkurvhhhhhhhhhhhhhheeeeeeejdawuttwbshhhoeejeeejdcuxnkknknknkkkknknrqhhhhhhhhhhhhheeeejpcaawrqhhhhhhhhhhhhleeeeeljjarqhhhhhhhhhhhoeeeeeejpaurghhhhhhhhhhhheeeeeeeepcwxirmhhhhhhhhhhheeeeeeepcuxrmhhhhhhhhhhhleeeeeeepdwxinnnkknitwcdjjjjpd`uxinnnmhhhhhhhhhhhhhhqcwxnnnnknnnxu``wtikkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkknkkkkkkkkkknkkkkkkkkkkknrshhhhhljmhhhhhhhhhhhhhoeejdatinknkanknnnuunkkxxknuini`rhhhhhhhhhhhhhhoeeeeeejed`tiiwwishhhljjjeeejdcxinnnkkkkkiuxukuighhhhhhhhhhhhhoeeeeejcaagghhhhhhhhhhhhoeeeeeejjjwghhhhhhhhhhhheeeeeeejd`trfhhhhhhhhhhhoeeeeeeejpauxnrqhhhhhhhhhhleeeeeejd`uirhhhhhhhhhhhhleeeeeejpawxnkknkknnxuwccdddcautinkkkrqhhhhhhhhhhhhhhpauxnknkkknixuutxnnkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkknknknknrshhhhhletrhhhhhhhhhhhhhheeepcuxnkkxxknnkwutwkntwnnutnnsghhhhhhhhhhhhhhoeeeeeeejd`xinuanshhhedppjejpccxnnnnnnnknna`waubmhhhhhhhhhhhhheeeeejepcabmhhhhhhhhhhhhleeeeeejjdbmhhhhhhhhhhhheeeeeeejcwrbhhhhhhhhhhhheeeeeeeejcwtinghhhhhhhhhhhleeeeeejdwtrshhhhhhhhhhhheeeeeeejcatinnkknknnnitu``a`wuxinkkkknghhhhhhhhhhhhhhqp`tinknkkknnxxinnkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkknknknkkkkkknkkkkkknkkrshhhhhleukrqhhhhhhhhhhhhhleejc`tnnkukkknn`da`kknunknuknrmhhhhhhhhhhhhhhleeeeeejpwxinnntishhheuccjjjpacinknwdddd`ktukukrvhhhhhhhhhhhhleeeeeejec`rqhhhhhhhhhhhoeeeeeeelparqhhhhhhhhhhhleeeeeejpawrmhhhhhhhhhhhheeeeeeejpauiirmhhhhhhhhhhheeeeeeejcwxrvhhhhhhhhhhhoeeeeeejpautinknknkknnnnxtttutxinnkkkkkkfhhhhhhhhhhhhhhhd`tnnnknknnnnnnkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknrbqhhhhleuknnmhhhhhhhhhhhhhheejpauinkuknkkutnnwnknunkkunkrfhhhhhhhhhhhhhheeeeeejjpwxnnnkunmhhlexcapjjd``inkknnnknknutkunrhhhhhhhhhhhhhleeeeejjjcughhhhhhhhhhhhleeeeeeejpgghhhhhhhhhhhhleeeeeejd`trqhhhhhhhhhhhleeeeeeejc`tinrqhhhhhhhhhhoeeeeeejpauirhhhhhhhhhhhhoeeeeeejp`tninnkknknkknnnnxiiinnnnknnknknqhhhhhhhhhhhhhhjawtnknkkkknknkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkknknknkkkkkkknkkkkibqhhhhoe`knnxghhhhhhhhhhhhhheeepcwxiniuknk`kkiaknn`nnuuknrhhhhhhhhhhhhhhoeeeeeejdduinnknukgqhlan``dppcw`irikknnnnnnuuktnshhhhhhhhhhhhoeeeeeejjdabshhhhhhhhhhhheeeeeeeejdbmhhhhhhhhhhhoeeeeeeejc`bghhhhhhhhhhhheeeeeeejpcuxnighhhhhhhhhhhleeeeeejd`uighhhhhhhhhhhhleeeeeejc`tnkknknkknkknkkknnnnnnnnnknknkkrqhhhhhhhhhhhhhhjautnknkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkknrbqhhhhoedniniusfhhhhhhhhhhhhhleepc`tinnakkkidcuwwnnicdxdtishhhhhhhhhhhhhhleeeeeeejjpankucddcadejppjjddjpdbsqmnkkknnxd`kdrmhhhhhhhhhhhhleeeeeeeec`rfhhhhhhhhhhhlleeeeeejd`rqhhhhhhhhhhhoeeeeeeepaurshhhhhhhhhhhheeeeeeejd`tinrmhhhhhhhhhhheeeeeeejc`trshhhhhhhhhhhheeeeeeepcuinnkknkknknnnkkknnknknknnknkkkknshhhhhhhhhhhhhhod`uxnnkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkknknkknkknkibqhhhhoednnixu`amhhhhhhhhhhhhhoeejd`uinnxxnkknknkkkknknknkrvhhhhhhhhhhhhhheeeeeeejcwxnnkkkkkknkknntwcdc`tibqhhcnkkkkknnnkrqhhhhhhhhhhhheeeeeeejpctbhhhhhhhhhhhheeeeeeeepdgghhhhhhhhhhhheeeeeeejdaurfhhhhhhhhhhhoeeeeeeepawxnnbhhhhhhhhhhhoeeeeeejpauirvhhhhhhhhhhhheeeeeejdatinnikknkkkkknknkkkkkknknnkknknknnmhhhhhhhhhhhhhhlc`tinknkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkirvhhhhhedkniiuwcdshhhhhhhhhhhhhheeepauxinnknkkkkknnkknknknnrqhhhhhhhhhhhhhheeeeeejpauxnnnknknkkknnnxwcdawxrvhhoeikkknknknnbhhhhhhhhhhhhleeeeeeejdabshhhhhhhhhhhoeeeeeeejparmhhhhhhhhhhhheeeeeeejcwxrhhhhhhhhhhhhleeeeeejp`uinrshhhhhhhhhhhleeeeeejd`uirvhhhhhhhhhhhheeeeeejdwtiknnnkkkknnknknkkkkkkkkknnnnkkkknnvhhhhhhhhhhhhhljcwtinkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkknkkirvhhhhoejknnxuwcdp`fhhhhhhhhhhhhhleepcwtinnnnnknnkkkkkkknkknghhhhhhhhhhhhhhoeeeeeejd`tinknkkkkkkkknitwacaurshhhlpnknnnknknimhhhhhhhhhhhheeeeeeeepcwrfhhhhhhhhhhhleeeeeejjdwrfhhhhhhhhhhhleeeeeejpaurghhhhhhhhhhhheeeeeeejcwxinrqhhhhhhhhhhheeeeeeejdwtnrhhhhhhhhhhhhoeeeeeejcwxnknkknkkkknnnkkkkkkkknkknknnnnkknnifhhhhhhhhhhhhhedauinnkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkknkkknknkkkrrvhhhhheliknit`adpdcshhhhhhhhhhhhhoeejdwtinnknknknknknknknnnishhhhhhhhhhhhhhleeeeeejdwtnnkkknnkkknknnxw`a`rbqhhhlwnnknnknnnrvhhhhhhhhhhhheeeeeeejdatbhhhhhhhhhhhoeeeeeeljpatbhhhhhhhhhhhheeeeeeeedatishhhhhhhhhhhoeeeeeejpawiirmhhhhhhhhhhhheeeeeeepcwxnrhhhhhhhhhhhhoeeeeejpawxnknnnknkkkkkkkkkknkkkrsrkknknnknknnbqhhhhhhhhhhhhejd`tinkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkknnrvhhhhheennnixuadpdcabhhhhhhhhhhhhhheejdatinnnnknkknknknnnkknrfhhhhhhhhhhhhhheeeeeeepawinnkknknkknnnnnxtw`brfhhhoexknnninnnnrhhhhhhhhhhhhleeeeeeejcwrshhhhhhhhhhhoeeeeeelpcwbshhhhhhhhhhhheeeeedejdwtrmhhhhhhhhhhhoeeeeeejd`uiirqhhhhhhhhhhhoeeeeeejp`txnrhhhhhhhhhhhhoeeeeejd`tnikknkknnrnkkkknknkkknbhhmnkknnknkknishhhhhhhhhhhhljjcwxnnkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknrmhhhhhllnnnituacpdc`urhhhhhhhhhhhhhhleepcwxnkknnnnkknknkknnnnrhhhhhhhhhhhhhhoeeeeeejpatinkknnkkknkkknnnxtxrvhhhholnknnixxinishhhhhhhhhhhheeeeeeejpaurvhhhhhhhhhhheeeeeeljpaurvhhhhhhhhhhhleeeejrsaawxrvhhhhhhhhhhhleeeeeejc`tnrshhhhhhhhhhhhleeeeedddwtnnrhhhhhhhhhhhhoeeeeejdwxxnnkknnnrghgkkkkknnkkkshhhcnkknnnnknnimhhhhhhhhhhhoejpawinkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknnrshhhhhleunnixwacppc`uxrmhhhhhhhhhhhhhleejd`tinkknknknnnnknknnishhhhhhhhhhhhhhoeeeeeejd`xinkkkknkknnknnnnnrrvhhhhheannnxxtxinrmhhhhhhhhhhhoeeeeeeejc`xrhhhhhhhhhhhheeeeeeljc`trqhhhhhhhhhhheeeeebghhctirvhhhhhhhhhhhleeeeeepauxibqhhhhhhhhhhhheeeeelrsswinkrhhhhhhhhhhhhoeeeeejcwxnnkkknkrbqhhfkkknkkkknshhhenkkkknkkknirqhhhhhhhhhhoeejd`tnnkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkrshhhhhleunnituacpdd`wxnnshhhhhhhhhhhhhheejpauxnnnkkknknnnnkknkimhhhhhhhhhhhhhhleeeeeejcwxnnkknnnkknnknknnirvhhhhhhexnnxuwwuxirfhhhhhhhhhhhleeeeeejjawrshhhhhhhhhhhleeeeeelpawrbhhhhhhhhhhhheeeearqhhl`iivhhhhhhhhhhhleeeeejp`wrrmhhfhhhhhhhhhheeeeegbhhfikkiqhhhhhhhhhhhheeeeejcuxnknkkkirfhhhldkknkkkkimhhhlnnnnkknnnknishhhhhhhhhhoeejpauxnkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkknrshhhhhletnnixwaddpc`wxiknrhhhhhhhhhhhhhheeejcwxnnknknknnnnnnknnrfhhhhhhhhhhhhhheeeeeejpaunnnnnnknkkkknkkkrrvhhhhhhoennxtwaawxibhhhhhhhhhhhheeeeeeejdaurvhhhhhhhhhhheeeeeeejpaurshhhhhhhhhhhoeeejrmhhoeunivhhhhhhhhhhhleeeeejd`trshhmhhhhhhhhhhoeeee`rqhhlcnnnvhhhhhhhhhhhheeeeepawxknnkkirvhhhoe`kkknkkkrvhhhounknnnkknnnnrqhhhhhhhhhoeeejdwxnkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkknrshhhhhoeannixw`cppdauxinkkifhhhhhhhhhhhhhoeejd`txnnnnkknknknknknbhhhhhhhhhhhhhhoeeeeeeedaunnnkknkkkwcxnnirbqhhhhhhhldnitwacawtrghhhhhhhhhhhheeeeeeejcwxrhhhhhhhhhhhheeeeeeejcwtrmhhhhhhhhhhhleeegghhhedinivhhhhhhhhhhhleeeeejcwrbqhhshhhhhhhhhhleeecrvhhoe`kknmhhhhhhhhhhhhoeeejpauinkkknrshhhhepnnkknnnkrfhhhhdniiiinnnknnnshhhhhhhhhleeejpatikkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkknkkkkkkkkkkkkkkkkkkinrshhhhhhejknixu`cpdcawtinknknfhhhhhhhhhhhhhheejpauxnnkknnknknnnknimhhhhhhhhhhhhhhleeeeeejd`tinknnknknkntnrrshhhhhhhhheuitucpdauxrfhhhhhhhhhhhleeeeeejpaurghhhhhhhhhhhoeeeeeelpcwxrvhhhhhhhhhhheeebbqhhleunnnmhhhhhhhhhhhheeeeeparbqhhvmhhhhhhhhhhleepbshhhepnnkkghhhhhhhhhhhhheeeepauxnkkirshhhhlenknnnknnnrhhhhhjixttxinknknnghhhhhhhhheeeeepawxnkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkknkkkkknnnkknrrghhhhhhoeitxxu`ddpdawwuxkkktrshhhhhhhhhhhhhhoeepcwxinkkntxuntinknrfhhhhhhhhhhhhhhleeeeeepcwxnnittnknnnnrrgfhhhhhhhhhoewwuapjjdairhhhhhhhhhhhhleeeeeejd`trmhhhhhhhhhhhleeeeeejdauxrfhhhhhhhhhhheebbqhhoeaxnnkshhhhhhhhhhhhqeeej`rbqhhorvhhhhhhhhhhleprshhhletnknkiqhhhhhhhhhhhhqeejp`tinnirvhhhhleukkniniiinrhhhhhhutuuuxinnnknrhhhhhhhhheeeeejcwxnkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkknnnxkkktnixikirvhhhhhhhopawtu`cppdcwuwuwxnktxshhhhhhhhhhhhhhhjejd`tinnkn`uw`t`nkrghhhhhhhhhhhhhhhleeeeejpcuxikutuwnknirgfhhhhhhhhhhhlj`p`djjpcwrghhhhhhhhhhhheeeeeeejcwxrqhhhhhhhhhhheeeeeeejdwtirhhhhhhhhhhhhvrbqhhoejtnnnirhhhhhhhhhhhhhvmwrrmqhhoerhhhhhhhhhhhfsrshhhleannnnnimhhhhhhhhhhhhhfcppatiirbfhhhhoewnnnixtutxighhhhhhjw`awtnnnnnnrhhhhhhhhleeeeejd`tikkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkknnkkkkininitrbvhhhhhhhhhdxwuwcppdcwtx`cutnnnrshhhhhhhhhhhhhhhqplddpcccwkxtkuntnirfhhhhhhhhhhhhhhhleeeeeejjdtnkwawtirrsfhhhhhhhhhhhhhed`adpjjcwxrmhhhhhhhhhhhoeeeeeejpauighhhhhhhhhhhoeeeeeejpcuxirhhhhhhhhhhhhhvhhhhleaxiknxtvhhhhhhhhhhhhhhvvhhhhheprhhhhhhhhhhhhvfhhhoepxiknnxxxqhhhhhhhhhhhhhqsgrrbsfhhhhhoednnkixww`uxrshhhhhhqaacauinnknighhhhhhhoeeeeeejd`xinkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkknnkkxnnirrgqhhhhhhhhhhmt``cdppc`uxwikntknirfhhhhhhhhhhhhhhhhqscawxnkkkxtktnxrrvhhhhhhhhhhhhhhhhqcpeeejc`xiitrrrbsvhhhhhhhhhhhhhhhoewcjjjjjawxrfhhhhhhhhhhhleeeeeejc`trmhhhhhhhhhhhleeeeeejdatinrhhhhhhhhhhhhhhhhhledwxinxtwshhhhhhhhhhhhhhhhhhhhelirhhhhhhhhhhhhhhhhoejuxinixtuushhhhhhhhhhhhhhhhhhhhhhhhhoecnknitu`aawtrshhhhhhhqddcwxnknnrfhhhhhhhleeeeeejd`tnnkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkknkkxrrgvhhhhhhhhhhhhhfgbuppc`uxiunirrrbsfhhhhhhhhhhhhhhhhhhhfsbrinknxxirrbsqhhhhhhhhhhhhhhhhhhqmsrrrrrrgsgmvqhhhhhhhhhhhhhhhhhhoe`djejejatxbhhhhhhhhhhhheeeeeeejcwtrfhhhhhhhhhhheeeeeeejcwxnnifhhhhhhhhhhhhhhhlejauxiiuw`wqhhhhhhhhhhhhhhhhhhlexkifhhhhhhhhhhhhhhheeauxxixww`wumhhhhhhhhhhhhhhhhhhhhhhhoedkkiixu`cca`trvhhhhhhhhmcd`tnnnrshhhhhhhleeeeeeejd`xnkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkknkkkkniinkkkngqhhhhhhhhhhhhhhhhhhqhpauxnktarvqhhhhhhhhhhhhhhhhhhhhhhhhhhhfskiaurvhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhejejeejjdddgshhhhhhhhhhhoeeeeeejpaurbhhhhhhhhhhhoeeeeeeepcuinknmhhhhhhhhhhhhhhleed`uxitu`awgqhhhhhhhhhhhhhhhhlewnnkmhhhhhhhhhhhhhheep`txxxuwa`wtimhhhhhhhhhhhhhhhhhhhhhlednnkxxu`cccauxrvhhhhhhhhhfgubrrbmhhhhhhhlejjeeeeejdwtnkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkknghhhhhhhhhhhhhhhhhhhhhj`tinkkkrhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhowkkkrhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhejjeeejjcuxrvhhhhhhhhhhhleeeeeejd`tishhhhhhhhhhhleeeeeejd`uxnnknhhhhhhhhhhhhhleejd`uttw`aawxshhhhhhhhhhhhhhheeaxnniiqhhhhhhhhhhhoeeedautttwaawuxinahhhhhhhhhhhhhhhhhhoeeunnnixuwaccawtirqhhhhhhhhhhhhvvfhhhhhhhhlepdjeeeeepcuxnnkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkrhhhhhhhhhhhhhhhhhhhhhewxnkkkkkhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhodnkkkhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhoejjeeejpauxnhhhhhhhhhhhheeeeeeejcwxivhhhhhhhhhhheeeeeeejd`tnnknkrhhhhhhhhhhleeeejdawuw`aawuxiwhhhhhhhhhhhhoeecwttxtuwhhhhhhhhhhleeejpawuw`aa`wtnnnn`ohhhhhhhhhhhhhholejxnnnxtu`cddawuxnrhhhhlllohhhhhhhhhhhhhhlee`wcjeeeejdauinkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkteeeeeeeeeeeeeeeeeeeeewxnnkkknkeeeeeeeeeeeeeeeeeeeeeeeeeeeeeepnnnkkeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeejd`tinneeeeeeeeeeeeeeeeeepauxnkdeeeeeeeeeeeeeeeeepcuxnnknknnoohhhooleeeeeeepcaaaaa`uxnnnxoohhhhhholeeejda`www`adohhhhhhoeeeeeepdaa`acawtxnnnnitplohhhhhhhhoolee`tttttu``ccdc`txinihhhel``dllohhhhhhhholeeaixwdjeeeejcwxikkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkknnnixuwadpeeeeejdwtinnnkkkkkknknnniixwapeeeeeeeeeeeeepc`txinnnnknknnkniiuwcpleeeeeeeeeeelpawxinnnnnnnnixxxxuuw`adpjjeeeeeeepcwtnknknnnniuadleeeeeeejp`tinkkknknixwdjeeeeeeejd`uinnkkknkn`peeeeeeeeeeeejpddccawtiiknniclllleeeeeeeejpccccccccpllleeeeeeeeejpdccca`uiiknknnxwajeelllleeeeepc`wwww`acddda`utnnnnglejxnxwdjeeelllleeed`knit`djeejjdauxnnkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkknknnixuwadjjeeeeejdawtxinnnkknkknnnixtu`cpleeeeeeeeeeeejpc`uuxiinnnknnnixuwapjeeeeeeeeeeeeejc`utxiniixxxxtuuw`acdppjeeeeeeeejpatxikknkkkniuapjeeeeeeejdwtnnkkkkknit`djeeeeeeejd`tnnknnknknniuapeeeeeeeeejjjdcawtinnknnixwcleeeeeeeeeejjpppdcawuucpjeeeeeeeeejjpdc`uxinkkkknitwcpjeeeeeeeeejppdcccddppdc`uxinkkkiuuxnit`djeeljjdc`iinnnnxwcpjeejpawxnnkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkknitw`cpjjeeeeeejjda`wtxnnkkknknixtuw`cpjeeeeeeeeeeeeeejpca`wutinnknnitw`cdjjeeeeeeeeeeeeejpcawwuuuuuwww``acddpjjjeeeeeeeeejd`tinnknkknnxucpeeeeeeejpcwinnkkknkiiuadjeeeeeejjawxnnkkknknknitadjeeeeeeeeejpdcwtinnknkkniu`djeeeeeeeeeeljjpdawttxuadjeeeeeeeejjpc`utinnknkkknitwcpjeeeeeeeeeejjjjjpjpdc`tixnknnnknkkkxtadjjeejpd`wuxxxxxw`djjjjpcwtinkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkknkixuacdjjjejeejejjddaawtinnkkknnxtw`acdpjejeeeeeeeejejjjjpdaa`utinnnitwacdpjjeeeeeeeeeejejjjddcaa`a`aaacccddppjjejejeeeeejjpcwxnknkknnknxwcpjeeeejejd`tinkkkkknnxuapjjeeeejjdauinknkknkkknixwcpeeeeeeeejjpa`txnknknknnnxwadjleeeeeeeejjpdawtiiitwcpeeeeeeeejpcauxinknknknknnxtwcdjjeeeeeeeeejjjjjpcawuxikikknknknnnitapjjjjjppcawuuuuwacpjjjda`txnnknkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkknntw`cdpppjjpjpjppddca`uxnnkkknixu`acddpppjppjpppjpjjjpppddcaawtxnnnxu`acdpppppppppjppjjpjppddccaccacccccddddppppppjppppjpdc`txnkkknkknnxwacpppppppdcwxinkkkknknxuacpppppppdawxinknnkknkknnxuacpjejejjjpcautinknkkknknnxxwadpjeeeejejjpd`wxinnniu`cpjeeeejjpc`utnnknkkkkkknnnxtwacppejeejejeejjpdcawuinnkkknknknkknxu`dppppddddcca```ccdpppcawxxnkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkknnxu`aaaccacccacacaaa`wtinkknkknitw`aaaacaacccccacccaccacaca``wtinnnitw`aaaaacacacaccccccacaaaa````a`aaaaaaaacccacaccdcacaawuxnnkknkknknxuwaaccccaa`wuinknkkkknnitwaaccccacawtinknknknnkknnnxu`cdpppddcawuxinnkkkkkkknnnitw`ddppjjppdda`uxikkknnxu`ddppppdcawuxnnknknnkknkknnnitu`acdppjjjjpppdc`wuxinnknkknkkkkknnit`cccaaaaaccccccacdcccawuxinkkkkkknkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkknixtuuuuuwuuuwuuuuuuttxixkkkknnixttuuuuuwuuuuwuwuuuwuwuwuuuuttxnnnnxattuuuwuuuuudauuutuuwu`uuuuuuwuuuac`cuwuawuuuwuwawwuutxxnnnkkkkknnnnxcwuuuuuuuttinnkkkkkkknnactuuuuu`ctxxii`iwikknkkknnixuw`aaa``wutxinkkkkkkkutkkknixuwaaccccaawutxnw`ikkkixu`acdccawuxinnnkkkkknknki`kknnxxuwaadccccca``wuxinnnkkkkkkknnknkkitu``wuuuuww```aaaaaa`wutxiknkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkknnixxxxxxxxiiiiiiixinnwnkkkkknnnniiiiiixixixxixixiixxxxxxxxiinnknnntiiixxxixxxxpxxixxiii`txxxxiuwixiucupixiiwixixixwiixxiinkkkkkkkkkknnniuxxiiiiuiinnkkkkkknkknntiixiiuxiatnnkdndxkknknkknnnxxtuuuuxxxinnnkknkkkkkxknkkknuxuuwwwwuuxxinnknxkkknnixuuwwuutxnnkkkkkknknkkkkxnknknnittuwawwwuuutxinnnkkkkkkkkkkkkkknnixuttxiixxttuuwwwuuuttxinnkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkknnknnnnnkninnnknnnnnkwkknknxinkntnxxinnxxnxtknnnnttnnnxxxtiknkkixnxnnnnnnnnnnuunnnnknnnwnnnnnnunnnnt`icnnnnunnknknitnnnknkknkkkiinxxknnnxxtnnniwxxxnkxixninnkkkxnnknkxnnnnknkck`nknkkknkknknnniiiiinnnkknkkknkkkkinxnkniwtuwtxututitnnkkkxnkkkknnixiutuxixknkkixnkkknxxnxkknnxxnniix`xxxxiinnnnkkkkkkkkkkkknkkkkkniininnnnnniixxxxxxiinnknkknkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkknkknknkknkknknkkkkkkkkiikkkkxxxtkkxwuxttknu`xx`kkxuxxwnkiwtxtiknxtxuwkkkkknkkknunkkkknkkiiknnnnntknkknukukkkkktkkkkkntkkkkkkkkkkkiuwxxwkkk`xxukknuxxnkkxwxwxtiknkxkkkkkiwinkkkk`kukknkkkkkkkknknnnnnknknkkkkkkkknkkutxtnknutttnntwtwxxtkkkkikkkkkknnnnx`xwxxxkkutxuxnkitxuwkkxuxiwnnnnxxnnnnnnnkkkkkkkkkkkkkkknkknknnnnknkkknknnnnnnnnnnnknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkxkkkkktwutkkktkkktkktkkknxnuixxtukkikkkxkkxkkktnnknkkknkkkkknkknkkxkkkkkkkxkkkkkkkknknkktnkkkkkntkkkkkkkkkkktkkknxnkxkkxkkkxkkkkkkukxkkxkkkxkkkkkkkktikkkknkkkkknknkkkkknkkkkknkknknknknkkkkkikkkxkkxkknnnk`ktkkxkknkxkknkwuwwwikwkxkkiknnkkkxkktkkktkkuiixtukkkkxkkkkkkkkkkkkkkkknkknkkkknkkkknknkkkkknknkkknknknkkknknkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkknkkkkkkkkkxkkkkxnkkxkkktkkkxnktkkknikwiixiinkxkkkxkkxkkkikkkkknkkkkkkkkkkkknikkknknkxknkkknkknkknknukkkkkkwkkkkkkkknkktkkknikkxkkxkkkxknkkkkwkikkxkkkxkkkkkikknxkkkkkkkknkkknknkkkkkkkkkkkkkkkkkkkkkkkkxkknxkkxknkkknwkxkkxnkknxkkkkkkkkknkwkikkikxkkkkxkkxkkkxknuxiixnkkkkxkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkknknkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkknkknikkkxkknukkkwnknxkkutknukkttkkknkkxnnkxkktnkiwkknkkkkkkkkkkkkkkkknxkkknkntkkkkkknkkkknkktkkkkkknnkkkkiukkkkttkntkkkxkkikkktkkknkkukxkkxkkkxkkkkkttxxkkkknknkkknkkkkknknkkkkkkknwiknkknkkkkkkxkkkxkkinknnkkwkikkinkkkxnknkkkkkkkkukikkikktnknxkktnkiwkktxkkknknktkkkkkkknknkkkkkkkkkkkkkknknkkkkkkkknkknkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkktkkknuuixtkkituxkkkinutnkkkiuwiknxuikxukkktuxnwkkknknknkkkknkkkkkkukknkkktnkkkkkknkkkkkkntkkkkkkukkkkiukkkkinutnkkuuknuukkkuwuikuukxnkukxuuwuikkkkiknkkknkkkkkknkknkkkkkkkkkkknunkknkkkkkknxunkuuikkxwuxktuinxkxinwuuutkkkkkkkktuinxkxnkkuuxkkkkuuxnukknuuiknkkukkkkkkkkkkkkkkkkkkkknkkknkkkkknknkkkkkkkkkkkkkkkkkknknkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkknkkkkknnkkkkkkkkkkikkkkkkikkkkknkkkknkkkkkknkkkkkkkknkkkkkkkkkkkkknkkkkkniknknkkxkkkkkkkknknkkknnkkkkkikkkkkkkkkkxkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkknknkkknkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkknkkknkkkkkkkkkkkkkkknknkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkxnkkkkkkkkkkknkkkkkkkkkkkkkknknkknkkkkknkkkkkkkknknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkuwtkkkkxwuknkkknkkkkknkkkkkkkkkkkkkkknkkknkknkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkxwunkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkknknkknkkkkkkkknkkkkkkkknkkkkkkkkkkkknknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkknkkkkkkkkkkkkkkkknkkknkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknknkkkkkkkkkknknkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkknkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkknknkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkknkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkknkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkknkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkknknknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkknkknkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknkkkkkkkkkkkkknkkknknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkknknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkknkknkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkknkkkknkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkknkknkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkknkkkkknkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkknnkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkknkkkknkkkkkkkkkkkkkkknknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkknkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkknknknktixikkkxkkkkkkinkkkkkkkkkkkkkkkkkkknxkkkkkkkkkkkkkkkkkkkkknxnkkkkkkikkkkkixnxkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkktikkkkkkkkkkkkkkkkkkkkktxkkkkknkkkkkkkkkkkkkkkkkkkkkkkkinkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkknkkkkkkkkkkkkkkkkkkxnkkkxixtkkkknkkkkkkikkkkkkkkkkkkkkkkkkkknkkkkkkknkkkkkkkkkkkkkkknkkkkkikkukkkntnukkkkkkkkkkkkkkkkkkkkkkknkkkknkkkknkkkkkknkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkknkkkkkkkikkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkikkkkxnixkkkkikkkkkkiknkkkkkkkkkkkknnnkkknknkkkkninnkkknnnknkkkkknkkkkknkkkkkknxktkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkinikkkninnnkkininnnkkkknkkkkkkkkkkkiniknnkkkknikkkkknnknkkkknkkkkkkikkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkknnkkknnnnnkkkkknkkkkkkikkkkkkkkkkknxnninkkninnnkkninnkkkinninikkkknkkkkkninkkkkkikikkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkxnnikkninnnkknxnxninkkknkkkkkkkkkkknxnxnnnkkxnnxnkkinnxnkkinniikkkknkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkikkkkkkikkkkkkkkkkknnnnnxkknkkknkkknkkkkknnknknkkkknkkkkkkkkikkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknkkknkkkkkkxknkknkkknkkkkkxxxxxkkxknkknknkkkknknkkkknkkinnnikkkknkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkknkkkkkkkikkkkkkkkkkinnnnnkkkkkknkkknkkkkknnknknkkkknkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknkkknkkkkkkiknkknkkknkkkkkkkkkkkkiknkknknkkkknknkkkknkkinnnnkkkknkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkknkkkkkknkkkkkiikkkkikkkkkknkkknkkknkkkkknkkkkkkkkknkkkknninkkkkkkkkkkkkkkkkkkkkkkkkkkkkikkkkkkkkkkkknkknkkknkkkkkkiknkknkkknkkkkkkkkkkkkiknkknknnkknkkknkknnkkxkkkkkkkknkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkknkkkkkkknkkkknnkkkkkiinkkknnknnnkkkinnkkinkikknkninnikkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkknikkkkkkkkkkkiikkiikkkninkkiiknnkiknninikkkkkkkkkinknkkikkkiinkkkkinnnnkkniikkkkknkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
-"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk"
-};
Add a comment to this file

etc/xemacs.xpm

Old
Old image
New
New image
 /* width height ncolors chars_per_pixel */
 "388 145 25 1",
 /* colors */
-"` c #686869",
-"a c #A6AAF5",
-"b c #585859",
-"c c #797979",
-"d c #09090B",
-"e c #989CEA",
-"f c #383839",
-"g c #363ACC",
-"h c #282829",
-"i c #88888A",
-"j c #13154C",
-"k c #7074DF",
-"l c #5256D8",
-"m c #484949",
-"n c #232788",
-"o s None c None",
-"p c #B8B8B9",
+"` c #787879",
+"a c #686869",
+"b c #A6AAF5",
+"c c #585859",
+"d c #484849",
+"e c #09090B",
+"f c #5256D7",
+"g c #989CEA",
+"h c #363ACC",
+"i c #C7C8CF",
+"j c #282829",
+"k s None c None",
+"l c #13154C",
+"m c #7074DF",
+"n c #D9D9DB",
+"o c #232788",
+"p c #383838",
 "q c #4249D0",
 "r c #B6BAF9",
 "s c #868AEB",
 "t c #A8A8A9",
-"u c #C8C8CF",
-"v c #989899",
-"w c #6266DB",
-"x s None c None",
+"u c #989899",
+"v c #6266DB",
+"w c #888889",
+"x c #B9B9B9",
 /* pixels */
-"xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx",
-"oxxoxxoxxoxxoxxoxoxoxoxxoxxoxxoxxxxoxxoxxxoxxoxxoxxoxxoxoxxoxxxoxxoxxoxxoxxoxoxxoxxoxxxoxxoxxoxoxoxoxxoxxoxoxoxxoxxoxoxoxoxoxoxxoxxoxxoxxoxxoxxoxoxoxoxxoxxoxxoxxxxoxxoxxxoxxoxxoxxoxxoxoxxoxxxoxxoxxoxxoxxoxoxxoxxoxxxoxxoxxoxoxoxoxxoxxoxoxoxxoxxoxoxoxoxoxoxxoxxoxxoxxoxxoxxoxoxoxoxxoxxoxxoxxxxoxxoxxxoxxoxxoxxoxxoxoxxoxxxoxxoxxoxxoxxoxoxxoxxoxxxoxxoxxoxoxoxoxxoxxoxoxoxoxxoxoxoxoxoxoxoxxoxx",
-"xxxxxxxoxxxxxoxxxxxxxxoxxxxxxxxxoxxxoxxxoxxxxxxxxoxxxxxxxoxxxoxxxxxxxxxxxoxxxxoxxxxxxoxxxxxoxxxxxxxxoxxxxxxxxxoxxxxxxxxxxxxxxxoxxxxxxxxoxxxxxoxxxxxxxxoxxxxxxxxxoxxxoxxxoxxxxxxxxoxxxxxxxoxxxoxxxxxxxxxxxoxxxxoxxxxxxoxxxxxoxxxxxxxxoxxxxxxxxxoxxxxxxxxxxxxxxxoxxxxxxxxoxxxxxoxxxxxxxxoxxxxxxxxxoxxxoxxxoxxxxxxxxoxxxxxxxoxxxoxxxxxxxxxxxoxxxxoxxxxxxoxxxxxoxxxxxxxxoxxxxxxxxxxxoxxxxxxxxxxxxxxoxxxx",
-"oxxoxxxxoxoxxxxxoxoxoxxxoxxoxxoxxxoxxoxxxxoxxoxxxxxoxxoxxxxoxxxxxxxxxoxxxxoxxxxxxxoxxxxxoxxxxoxoxoxxxxoxoxxoxxxoxoxxxoxoxoxoxxxxoxxoxxxxoxoxxxxxoxoxoxxxoxxoxxoxxxoxxoxxxxoxxoxxxxxoxxoxxxxoxxxxxxxxxoxxxxoxxxxxxxoxxxxxoxxxxoxoxoxxxxoxoxxoxxxoxoxxxoxoxoxoxxxxoxxoxxxxoxoxxxxxoxoxoxxxoxxoxxoxxxoxxoxxxxoxxoxxxxxoxxoxxxxoxxxxxxxxxoxxxxoxxxxxxxoxxxxxoxxxxoxoxoxxxxxoxoxxoxxxxxxxxoxoxoxoxxxxxoxx",
-"xxxxoxxxxxxxxxoxxxxxxxxxxoxxxxxoxxxxxxoxxxxxxxxoxxxxoxxxoxxxoxxoxxxxxxxxxxxxoxxxoxxxxxoxxxoxxxxxxxoxoxxxxoxxxxxxxxxoxxxxxxxxoxxxxxxxoxxxxxxxxxoxxxxxxxxxxoxxxxxoxxxxxxoxxxxxxxxoxxxxoxxxoxxxoxxoxxxxxxxxxxxxoxxxoxxxxxoxxxoxxxxxxxoxoxxxxoxxxxxxxxxoxxxxxxxxoxxxxxxxoxxxxxxxxxoxxxxxxxxxxoxxxxxoxxxxxxoxxxxxxxxoxxxxoxxxoxxxoxxoxxxxxxxxxxxxoxxxoxxxxxoxxxoxxxxxxoxoxxxxxxoxxxoxoxxoxxxxxxxxoxoxxxxx",
-"xoxxxoxxxxoxoxxxxxxoxoxoxxxxoxxxoxxoxxxxxoxxoxxxoxxxxxxxxxoxxoxxoxxxxoxxxxxxxoxxxxoxxxxxxxxxxxoxoxxxxxxoxxxoxxoxxoxxxxxxxoxxxxxoxoxxxoxxxxoxoxxxxxxoxoxoxxxxoxxxoxxoxxxxxoxxoxxxoxxxxxxxxxoxxoxxoxxxxoxxxxxxxoxxxxoxxxxxxxxxxxoxoxxxxxxoxxxoxxoxxoxxxxxxxoxxxxxoxoxxxoxxxxoxoxxxxxxoxoxoxxxxoxxxoxxoxxxxxoxxoxxxoxxxxxxxxxoxxoxxoxxxxoxxxxxxxoxxxxoxxxxxxxxxxoxoxxxxxoxoxxxxoxxxxxxxxxxxxoxxxxxxoxox",
-"xxoxxxxoxxxxxoxxxoxxxxxxxxoxxxxxxoxxxoxoxxxxxxxxxxoxxoxxxxxoxxxxxoxxxxoxxoxxxxxxxxxxoxxxxxxxoxxxoxoxxoxxxxxxoxxxxxxxxxxoxxxoxxxxxxoxxxxoxxxxxoxxxoxxxxxxxxoxxxxxxoxxxoxoxxxxxxxxxxoxxoxxxxxoxxxxxoxxxxoxxoxxxxxxxxxxoxxxxxxxoxxxoxoxxoxxxxxxoxxxxxxxxxxoxxxoxxxxxxoxxxxoxxxxxoxxxoxxxxxxxxoxxxxxxoxxxoxoxxxxxxxxxxoxxoxxxxxoxxxxxoxxxxoxxoxxxxxxxxxxoxxxxxxxxxxxooxoxxxxoxxxxoxxxoxxxxxoxxxoxxxxxxxx",
-"xxxxxoxxxoxxxxoxxxxxoxxoxxxxxxoxxxxoxxxxxxxxoxxxoxxoxxxxoxxxoxxoxxxxxxxoxxxxxoxxxxxxxxxxxoxxxxxoxxxxxxxoxoxxxxoxxoxxoxxxxxxxoxxoxxxxxoxxxoxxxxoxxxxxoxxoxxxxxxoxxxxoxxxxxxxxoxxxoxxoxxxxoxxxoxxoxxxxxxxoxxxxxoxxxxxxxxxxxoxxxxxoxxxxxxxoxoxxxxoxxoxxoxxxxxxxoxxoxxxxxoxxxoxxxxoxxxxxoxxoxxxxxxoxxxxoxxxxxxxxoxxxoxxoxxxxoxxxoxxoxxxxxxxoxxxxxoxxxxxxxxxxxoxxxxoxxxxxoxoxxxoxxxoxxxxxoxxxxxxxoxxxxoxx",
-"xoxoxxxxxxxoxxxoxxxxxoxxoxxxoxxxoxxxxxxxxoxxxxxxxoxxoxoxxxxxxoxxoxxoxxxxxxxoxxxxxxxxxxoxxxxxxxxxxoxoxxxxxxoxxxxxxxxxxoxxxxxxxxxxxoxxxxoxxxxoxxxoxxxxxoxxoxxxoxxxoxxxxxxxxoxxxxxxxoxxoxoxxxxxxoxxoxxoxxxxxxxoxxxxxxxxxxoxxxxxxxxxxoxoxxxxxxoxxxxxxxxxxoxxxxxxxxxxxoxxxxoxxxxoxxxoxxxxxoxxoxxxoxxxoxxxxxxxxoxxxxxxxoxxoxoxxxxxxoxxoxxoxxxxxxxoxxxxxxxxxxoxxxxxoxxxoxxxxxxoxxxxoxxxxxxxxoxxxxxxxxxoxxox",
-"xxxxxoxoxoxxoxxxoxxxxxxxxoxxxxoxxxxoxxxxxxxxxxxxxxoxxxxxxoxoxxoxxoxxoxxxoxxxxoxoxxxxxxxxxxxxoxxxxxxxoxxoxxxoxxoxxxxxoxxoxxxxxxxxxxxoxxxxxoxxoxxxoxxxxxxxxoxxxxoxxxxoxxxxxxxxxxxxxxoxxxxxxoxoxxoxxoxxoxxxoxxxxoxoxxxxxxxxxxxxoxxxxxxxoxxoxxxoxxoxxxxxoxxoxxxxxxxxxxxoxxxxxoxxoxxxoxxxxxxxxoxxxxoxxxxoxxxxxxxxxxxxxxoxxxxxxoxoxxoxxoxxoxxxoxxxxoxoxxxxxxxxxxxxxxxxxxxoxxxxxxoxxxxoxxxxoxxoxxxxxxxxxxxx",
-"xxoxxxxxxxxxxxoxxxoxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxoxoxxxxxxxxxxxxxxxxoxxxxxxxxoxoxxxxxxxxoxxxoxxoxxxxxxoxxxoxxxoxxxxxxxoxxxxxxxxxxxoxoxxxxxxxoxxxoxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxoxoxxxxxxxxxxxxxxxxoxxxxxxxxoxoxxxxxxxxoxxxoxxoxxxxxxoxxxoxxxoxxxxxxxoxxxxxxxxxxxoxoxxxxxxxoxxxoxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxoxoxxxxxxxxxxxxxxxxoxxxxxxxxoxoxxxxxxxxxxxoxxxxxxxoxoxxxoxxxxoxxxxxxxoxxxxxxxoxxx",
-"xxxoxxoxuuxoxxxopxxxxxxxxxuuxxxxoxxxoxxxxxxxxxoxuuoxxxoxoxxxoxoxopoxxxxxoxxxooxxxxxxxxxxxxxxoxxxxxxxoxxxxxxxxxoxxxxxoxoxxxxxxxxxxxxxxpoxoxxxoxxxxxxxxxxpoxxxxxxxoxxxoxxxxxxxxpooxxoxxxoxoxxxoxxoxxxxxxxxoxxxooxxxxxxxxxxxxxxoxxxxxxxoxxxxxxxxxoxxxxxoxoxxxxxxxxxxxxxxxxxoxxxoxxxxxxxxxxxxxxxxxxxoxxxoxxxxxxxxoxoxxoxxxoxoxxxoxxoxxxxxxxxoxxxooxxxxxxxxxxxxxxxxxxoxoxxxxxxxxxoxoxxxxxoxoxxxxxxxxxxoxx",
-"xxxxxxxxxoxxoxxxuxxxxxxxxxxuxxoxxxxxxxxoxxxxxxxxxuxxoxxoxxxxxxxoupxoxxupppxxxxxxxxxoxpptpuuxxxoxxxxotuxotuxxoxxxoxxxxxxoxxxxxxxxxxoxxxuxoxxxxxxxoxxxxxxxuxxxxoxxxxxxxxxoxxxxxxuxxxxoxxoxxxxxxoxxoxxxoxxxxxoxxxxxxxxoxxxoxxxxxxoxxxxxxxoxxxxoxxxxoxxxxxxoxxxxxxxxxxoxxxoxoxxxxxxxoxxxxxxxxxxxoxoxxxxxxxxoxxxxxxxxoxxxoxxoxxxxxoxxoxxxoxxxxxoxxxxxxxxoxxxoxxxxxxoxxxxxxxxxxxxxxxxxoxxxxxxoxxoxxxxxxxxx",
-"xoxxoxooxoxxxouooxxxxxxxxxxooooxooxouoxxoxxuuxoxxuxouuxxoxxxxoxxtuxxxxxxuxxxxxxouoxxxoxoxxoxxxuuooxxopxuoxxxxxxxxooouxuoxoxouoxxxxxooxuxxxuuoxxxxxxxxxxxuouxxxxxuuoooxxouoxoxxuxuuoxoxxoxxxxxxoxxoxxxoxxoxxxxxxxxxxxxxxxxxxxxxxxoxxoxxxxxxxxxxxxxxxxxoxxxoxxoxxxxxxxxxxxxxoxxxxxxxxxxxxxoxxxxxxxooxooxxxoxxxxxoxxoxoxoxxxxxxxxoxxoxxxoxxoxxxxxxxxxxxxxxxxxxxxxxxoxxoxoxoxxxxxxxxxxxxxoxxxxxoxoxxxoxx",
-"xoxxxuoouuoxuuoppxxxxxxxxxopuuuoxxupuppxxopuupooxuxpuoxxxoxxxxxopxxxxoxxuxoxooxouuoxxxxuxxxxxpuuuuxoxuupxxxxxxxxxopuupupxxupuupxxxpuupoxopuupuxxxxxxxxxxtuupxxxpuopuxoupuupxxxuxtuoxoxxoxoxxoxxoxxxxxxxxxxoxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxoxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxooxxoxxoxxxxxxxxoxoxoxxoxxoxxxxxxxxxxoxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxoxxxxoxxxxx",
-"xoxxoxoxxuxxuxxxuxxuptptuxxuxxxuxxuxxxooouxxxxuxxutoxoxoxxoxxxxxxxoxxxxxuxxxxooppuoxxxxoxxxxuuouutxxxotoxxxutptpuxuuxuxuxxuxxoxuxuxxxouxuuuuotxxppptpoxxoxxuxxooxxxuxxuxxoxuxxppoxxoxxxxxxoxxxxxooxxxxxxoxxxxoxxxxxxxxxxxxxxxxxxxxoxoxoxxxxxxxxxxxxxoxxoxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxoxxxxxooxoxoxxxxxxoxxxxxooxxxxxxoxxxxoxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxooxxxxxoxxxxxoxx",
-"xoxxoxxxxoxxoxxxuxxxxxxxxxxuxxxuxxuxoxouxuxoxxuxxuotxoxxxoxxxxxxoxoxxxoxuxxuxxpoxouxxxxuxxxxpuuouuxxxtxpoxxxxxxxxouuxuxuxxuxxxxuxuxxxxuxpuouuuxxxxxxxxxxuxxuxxuxxxxuxxuoxxxuxxpuuxxxooxoxoxxxxxxxxoxoxoxoxxoxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxooxxoxxoxxxxxoxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxoxoxxoxxxxxxxxooxooxoxxxxxxxxoxoxoxoxxoxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxooxxxoxxxxxxoxoxxox",
-"xoxxoooxuuxxuoxotxxxxxxxxxxuxxxuxxpuxopxoopxxpoxxuxopxxxoxxxxxxoxxxoxxxouoouxxuoxuuxxxxuxxxxotoxxoxxpoxotxxxxxxxxxuuouxuxxuuxopoxuuxopuxotoxxxxxxxxxxxxxuxxuxxxpoxopoxpoxotxxxuxuuxxxxxxxxxxxxxoxoxxxxxxxxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxoxxxxoxxxoxxxxxxoxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxoxxxxxxxxxxxxxxxxxxxoxoxxxxxxxxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxoxxoxxxxxoxxxxx",
-"xooxxxuuouuxxppuotxxxxxxxxutoxttoxxpttoxxxuttooxppxxttoxxxoxxxxxoxxoxxutttttxxuttotuxxpttuxxxxptpoxotuxotpxxxxxoxutpxtoupxopttoxxxutpotoxoptpxxxxxxxxxxttxottxxoptpxxxoptpooxtuxotpxxoxoxxoxxxxxxxxoxxxoxxxxxxoxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxoxoxxxoxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxoxxxxxxxxxxxxxoxxoxxxxxxxxxoxxxoxxxxxxoxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxoxxxoxoxxxxoxxx",
-"xxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxoxxoxxoxxxxxxoxxoxxxxoxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxooxxxxxxxxxxxxoxxoxxoxxxxxxxoxoxxoxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxoxoxxxxxxoxxoxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxoxoxxxoxxoxxxoxxoxxoxxxxxxxoxoxxoxxxxoxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxoxxxxxxxxxoxoxxoxx",
-"xoxxxxxxxxoxxxoxxxxxxxxxxxxxxxxxxxxxooxxxxoxxxxxxxxoxxxxoxxoxxxxoxoxxxxoxxxxoxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxoxxxxoxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxoxoxoxxxxxxxxoxxxxooxoxxxxoxoxxxxoxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxoxxxxxxxxxxoxxxxooxoxxxxoxoxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxoxxxxxoxxox",
-"xxxoxxoxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxoxxxxoxoooxxxxxxxxoooxxxxxxxxxxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxoxxxxxxxxxxxoxoxxoxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxoxxooxxxxxxxxxoooxxxxxxxxxxooxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxoxoxxxxxxxxxxxxoxoxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxoxxoxxxxxxoxxxoxxoxoxxxxxxxxoooxxxxxxxxxxxoxoxxxxxxxxxxxxxxxxxxxxxxxxxoxoxxoxxxxxxxxxxxoxxxxxx",
-"xoxxoxxxxxxxoxxxxxxxxxoooxxxxxxxxxxxoxoxxooxoxxxxoxoxxxxxxxxxxxxxxxoxoxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxoxxxxxxxxxxxxxxxooxxxxxxxxxoxxxxxxxxxoooxxxxxxxxxxxxxooxxoxoxxxoxxxoxxxxoxxxxxxxxxoxoxxoxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxoooxxxxxxxxxxxoxoxxxooxxxxxxxxoxxoxxxxxxxxxxxoxoxxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxoxxoxxxxoxxxxoxoxx",
-"xxxxxxoxoxxxxxoxxxxxxxxxxoxoxxxxxxxxxxxooxxxxxxxxxxxxxxoxoxxxxxoxoxxxoxoxxoxxxxxxxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxoxxxxooxxxxxxxxoxxxxxxxxxxooxxxxxxxxxxxxxoxxxxxxxxxxxxxxoxxxxxxxoxoxxoxoxxxoxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxoxxxxoxxooxxxxxxxxoxxxxxoxxxxoxoxxxxxxxxxxxxoxxxxxxxoxxxxxoxxxxxxxxoxoxxoxoxxoxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxoxxxxxxxxoxxxoxxx",
-"xoxoxxxxxxxoxxxxxxxooxooxoxxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxoxoxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxoxoxoxxxxooxxoxxxxxxxxxxxxxxooxoxxoxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxooxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxoxxxoxoxoxxxxxoxxoxxxxxxxxxxxxxxxooxooxxoxoxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxoxooxxxoxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxoxxxoxoxxoxxxxox",
-"xxxxoxoxxxxxooxooxxxxxxxxoxoxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxooxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxoxxxxxooxxxxxxxooxooxxxxxxxxoxoxxxoxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxoooxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxoxoxxooxxxxxxxooxooxxxxxxxxoxoxxxxoxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxoxxooxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxoxxx",
-"xoxxxxxoxxxxxxxxxxxxxxoooxoooxoxxoxoxxxxxxxxxxxxxxxxxxxxxxxxooxxxxuxxxiixooxxxxxxxxxoxxxxxovxxxxxxxxxxupxxxxxxxxxxxxxxoxxoxxuxxxxuxxxxoxxxxxxxoxxxxxxxoooxxooxoxooxoxxxxoxxxxxxxxxxxxxxxxxxxooxxxxoxxxooxooxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxoxxxxxoxxxoxxxxxxxoxxxxxxxooxxoooxoxxooxxxxxxxxxxxxxxxxxxxxxxxxxooxxxxxxxxooxooxxoxxxxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxoxxoxoxxoxx",
-"xxxoxoxxxxxxxxxooxxoxxxxxoxxoxooxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxvoxxxxpxxxxoxxoxoxxxxxxxxxuxxxxxxxxxxxuxxxoxxxxoxxxoxxxoxxovoxxxvxoooxoxxxxxxxxooxxxxxxxooxxoxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxoxxxxoxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxoxxxoxxxoxxxxxxooxoxxxxxxxxooxxxxxxxoxxoxooxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxoxxxoxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxoxoxxxxxxoxxxxxxxox",
-"xoxxxxooxxxxxxxxoxxxoxxxxxxxxxxoxoxxxxxxxoxxxxxxxxxxxxxoxxxxxxxxxvxxxxxtooxxoxppoxxpupoouxxpxouxxxxxuuxpxxxupuxxxxoxxxxxxxxpuxxxouuxxxxoxxxxxxxxoxxxooxoxxxoxxxxxxoxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxoooxxoxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxooxxxxxxxxxxxxoxxoxxxoxxxxxxxxoxxxooxooxxxxxxoxxoxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxoooxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxoxxxxxoxoxoxxx",
-"xxxxoxxxxxxxxxxoxxxoxoxooooxooxxooxxxxxxxxooxxxxxxxxxxxoxxxxxxxxuoxoxxxpxxxxxuppvoxpipiptuxpvtpixxxvupipxxopptuxxxxoxoxxxxxtxxxxxxtxxxxxxxxxxxoxxxxoxxxooxoxooxxooxxxxxxxoooxxxxxxxxxxxoxxxxxxxxxxxxxxxoxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxoxxxxxxxxxxxxxxxxxxxxxxoxxxoxxxxxoooooxxooxxxxxxxxooxxxxxxxxxxxoxxxxxxxxxxxoxxxoxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxoxxxxxxxxxxx",
-"xoxxxxoxoxoxxxxxooxxxxxxxxxxxoxxxxxxxxxxxoxxxxxxxxxxoxoooxxxxxxxpxxxxxxpooxoxuiivxxxixpxxpxpoxxxtxuxxxxtxxxvitpxxxxxxxoooxxpoxoxxopoxoxxxxxxxxxxooxxxxxxxxoxxoxxxxxxxxxxxxxxxxxxxxxxoxoooxxxxxxxxxxxxxxxooxoxoxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxoxxxoxoxxoxxxxoxxxxxxxxxooxxxoxxxxxxxoxxxxxxxxxxoxxxxxxxxxxxoxoooxxxxxxxxxxxxxxxooxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxoxoxxoxxxoxo",
-"xxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxpxxxxxopxoxoovxxtoxoixpxxpxpxxxxpxpxxxxuxxtoxopxxxxxxxxxxxxpoxxxxxpxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxoxxxoxxxxxoxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxoxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxoxxxxxxxooxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxoxxoxxxx",
-"xoxxxoxxoxoxxoxxxxxxoxxxoxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxoxxoxpxxxxotxxxxpoxxixoxcxpxxpxpvoxuuxovxxtvxxtxxppxxxxxxxxxoxxtxxxxxopxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxoxxxxxxooxxoxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxoooxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxoxoxxxxxoxxx",
-"xxxoxxoxxxxoxxxxxoxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxoxxxvoxopccccuxxviipixcixvuxcuiociuxxxxicuttxpiioiuxxxxxxxxxxxuvxoxovuoxxxxxxxoxxxxooooouoooooxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxoxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxoxoooxxxxxxxxoxxxxoxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxoxxxxxxoxxoxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxoxoxxox",
-"xoxxxxxoxoxxoxxoxxxoxxxxxxxxxxxxxuururuurrrruururrurururrrrrrrruxuuoxxxxurrrrrrrrrrrrrrrrrrruxxxxxxxxrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrssssssssseaxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxoxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxoxoxxxxxooxoxooxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxoxxoxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxoxxxxxxoxxxxox",
-"xxoxoxxxxxxxxoxxxxxxxxxxxxxxxxxxxrgqggggqgqgggggqggqggggggggggggkxxxxxxxrwgggggggggggggggggggkxxxxxxxrggggggggggggggggggggggggggggggggggggggggggggggqggggggqtxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxoxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxoooxxxoxxxxxxxoxoxoxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxoxxoxxoxoxxx",
-"xxxxoxoxxoxoxxoxoxxxoxxxxxxxxxxxxuggggggggggggggggggggggggggggggnmxxxxxxowgggggggggggggggggggnmxxxxxxogggggggggggggggggggggggggggggggggggggggggggggggggggggndxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxoxxxxoxxxoxxooxxxxxxxxxxooxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxoxxxoxxxooxxxxoxxoxxxxoxx",
-"xxoxxxxxxxxxoxxoxxxxxxxxoxoxoxxxxxknggggggggggggggggggggggggggnnjmxxxxxxxegnggggggggggggggggnjmxxxxxxxkngggggggggggggggggggggggggggggggggggggggggggggggggggjmoxxxoxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxooxxxxxxxxxoxoxxxxxxxxxxxxxxxxxxxoxxxxxxxxoxxooxxxxxxoxxxxoxxxxoooxxxxxxxxxxxxxoooxxxxoxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxoxoxxxxxxxxxxxxxxxxxxxooxxxxxxxxoxoxxxxxxoxxox",
-"xxxxoxoxoxxxxxxxoxxxxxoxxxxoxoxoxoxbfjjgggggggggggggggggggnjddfmmcxoxoxxxximmmqggggggggggnjddfcxoxxxxxxmmjdnqggggggggggggggggggjdddddddjjnnggggggggggggggggjcoooooxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxoxxxxoxxxoxxxxxxxxooxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxoxxxxxxxx",
-"xxoxxoxxxoxoxxxxxxxxxxxxxxxxxxxxxxxxxopclggggggggggggggggjdmtooooouooooooxxxxosgggggggggjdf`ououoooxxxxxxxxueggggggggggggggggndjcpuuuouviimfjngggggggggggggdiuuuuooxxxxxxxxxxooxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxoxooxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxooxxxxxxxxxxxxxxxxxxoxoxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxoxx",
-"xxxoxxoxxxxxxoxxxxxoxxxxxxxxxxxxxxxxxoxuokgggggggggggggggjmpppupuppptpuuoxxxxusggggggggdd`ppppppppuuuoxxxxxouwgggggggggggggggdhpppuppppppppppcmnggggggggggndtptpppuoooxoxxxxxooxooxxxxxxxxxxxxxxxxxooooxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxoxoxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxoxxxxxooxooxxxxxxxxxxxxxxxxxooooxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxoxoxxxxoxxox",
-"xoxxxxxxoxoxxxoxxxxxxxxxxxxxxxxxxxxxxxxourlggggggggggggggdbiiiiiivvvvvtpuoxxxrwggggggnddciiiiiivvvttpuoxxxxorwggggggggggggggndciiviiviiviiiviviimqggggggggjhciciivpuooxxxxxxxxoxooxoxxxxxxxxxxxxxxxxooxxxxxxxxxxxxxxxxxxxxoooxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxoxxoooxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxooxoxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxoooxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxoxxxxxxx",
-"xxoxxoxxoxoxoxxxxxoxxxxxxxxxxxxxxxxxxxxoptkggggggggggggggjbbbbb`b```ccvppuoxuaggggggndhm`bb`b`b`b`citpoxxxxorwggggggggggggggjjbbbbbb``b``````````bqgggggggjhmbmb`cvpuxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxoxoxooxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxoxxoxxoxox",
-"xxxoxxoxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxoopvaggggggggggggggjhhfhfffmb``cituoxurlgggggnddjhfhfhfffmmb``mbtxxxpurgggggggggggggggdhhfhffffhfbbbbbbbbbmmwqggggggddhhhhf`ipuxxxxxxxxxxxoxxxxxxxxxxxooxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxvtxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxoxxxxx",
-"xoxxxxxoxoxxoxxxxxxxxxxxxxxxxxxxxxxxxxxopvvwgggggggggggggndddhdhfmm`civtuoorkgggggndhfhdhdhdhhhfbbcbpuxxxxuurggggggggggggggndddhddhhfmfb``````bbbmmkggggggdddddhhb`bm`oxxxxxxxxxov``b`bxxooxxoxxmbxxbcxxxxxoxxxxxxxxxxxxxxxxxxxxxxpxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxoooxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoooxxxxxxooxoooxxoxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxx",
-"xxxxoxxxxxoxxxooxxoxxxxxxxxxxxxxxxxxxxxooptsggggggggggggggdddddhfbcivtpuuursgggggndhmmfddddddhfb```bvtxxxttusggggggggggggggjdddddddhfbbi``cvii`bb`bsqggggnddddddfbitvoxxxxxuttxxxtoxvxtxxxpvpoooomxocoxxxxxxxxpopxuoxxxxtuxxxxxppxuxxxotoxxxxxxxxxxpupxtoxxxutuxootxttoxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxoxxxxxxooxxoooxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxoxxxoxx",
-"xxxxxoxoxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxoouurggggggggggggggddddhfbcvtppuoouegggggndfbbfhdddddhhfcvii`vpxxxtcrkggggggggggggggjddddddhfbc`tbcippb`cbbiikggggjdddddhfbipvxxxxxxtttioxxxxtxxxocivicxxxuc`xxxxxxxxxxt`t`tvuxx`tpcxxxipt`vxxivtiixxxxxxxxxcvvipcxxuttvuxuicvtcpxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxoxooooxoxooxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxx",
-"oxoxxxxxxxoxxxxxxxxoxxxxxxxxxxxxxxxxxoxoxxouwgggggggggggggjdddhf`ituuuooraqggggndmiui`fhdddhhmhvpuuvoooxxxtrlggggggggggggggddddddddfcvcbtooop`vvimvtsggggddddddhf`vpvoxxxxxvbcvxxxxxtxxxucttvbpooo`iooxpc``bcxx`xpxxpxpxxxxpxtoxxxvxucttt`uxvc`ccvxttxvxtxxocbvtxxvoxxxixxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxoxxxxoooooxoxooxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxox",
-"xxxoxoxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxoxooxxokgggggggggggggndddhfctpoxxxraqgggggdmovpibfdhdhfm`cpuootoxxxoxarggggggggggggggnddddddhfbvpcp`ooxpcvvtvpueggggdjddddhf`tpvoxotxtpooixxxxxvxxxpcvvttoxxipttxxxxxxxxxx`xpxxpxtxxxxtxtxxxxtxpcttvtoxxxoxxxxptxtotxxvxxxtxxtuxxxvxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxoooxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxooxoxxxxxxxxxx",
-"oxxxxxoxoxoxxxoxoxxxxoxxxxxxxxxxxxxxoxxxoxxxrggggggggggggggdddhmctuooxraqgggggddooicimhdhhh`vttoooxvxxxxxxasggggggggggggggjddddddhmctuvxucxoxbpxouxxrgggndfhdddhmctuvxxxvxixxocxxxxxtxoxobuxxxxxttxx`oxxxxxxxxx`xpxxpxotxxvuxocxoicxxbpooooxxxxxxxxptxtovoovxxtuxxtcoxipoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxooxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxoxxoxxxoxx",
-"xoxxxxxxxxxoxxxxxxoxxxxxxxxxxxxxooxoxooxxxooulgggggggggggggjddhmctoxxuaqggggnddooop`hhhdhm`mmcuooibbbixxtbrkggggggggggggggdddddddfbvpcioxbbxxxibcpoxrgggndbhhddfbcvbbbbbuxubbtiixxtb`booxxibcpxx``xx``xxxxxxxx``xvuxcxxu``pxxxobbpiixxi`cpxxxxxxxxobix`opixvbbubpxpocbuxxoxxxxxxxxxxxxxxxxxxxxxxxoxooxoxxxooxxxxxxxxxxooxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxoxxxxx",
-"xxoxxxxoxoxxoxoxxxxxxxxxxxxxxxoxxooxxxooxxxxokgggggggggggggnddhf`vpoorlgggggdjvpoutcbfhfmcvtuxxxooxxxxxxxorqgggggggggggggnddddddhf`vpoxxxxxoxoxxxxxxrgggjmcmhdhfbitooxooxxxxxoxxxxxxxxxxxoooxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoooxoxxxxxxxxxxxxxxxxxxxxoxxxxxxxxtxxxxxxxxoxoxxxxxxxxxxxxxxxxxxxuoxxxooxxxxxoxxxxxxxoxxxooxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxooxoxxxxxxxxxxxxxxxxxxxxoxoxxxoxoxx",
-"xxxoxxxxxxxxxxxxoxxoxxxxxxxxxxoxxxooxoxoxxxxxaggggggggggggggdddfbvprrwgggggdjuxoptibfffb`ituoxxxxoxooxxxxoaggggggggggggggndddddddm`voxxxxxxxxoxxoxxoegggdcibfhhf`ttuooxxoxxxxxxxxoxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxoxxxxxxxxxxxxxxxxxxxxxxxxxxpmbpxxxxxxxxoxxoxxxxxxxxxxxxooxxxooxoxoxxxxxxxxxoxxxxxoxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxoxxxxxxxxxxxxxxxxxxxxxoxxxxoxx",
-"xoxxxoxxxxxxxoxoxxoxxxxxoxxxxxxoxxoooxooxxxxxuqgggggggggggggjddhbirrwggggnddoouuti`fffbcvtuooxxxxoxooxoxxrsggggggggggggggjddddddhmivuoxxxxooxxxoxooookngdtv`fhhmcppooxooxxxxxxoxxxoxxxxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxoooxxxxxxxxxxxxxxxxxxxxxoxxxxxxoxooxxxxxxxxxxoxxxoxxxxxxxxxxxxxxoooxooxxxxxxoxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxooxooxxxxxxxxxxxxxxxxxxxxxoxxxxxxxox",
-"xxxoxoxxxxxxxxxoooxooxxxxxoxxxxxxxxxxoxxxxxoxokgggggggggggggnddhmtrwgggggdjuxoutibmffm`vpuooxxoxxxxooxxxxrwggggggggggggggddddddhhbipuoxxxrswarxooooxoxmhdutcmffbipxuxoxxxxxoxxxxxxxoxxxxxxoooxxxxxxxxxxxxxxxxxxxxxxxxxxxxxooxxxxxxxooxoxxxxxxxxxxxxxxxxxxxxxxoxxoooouoxxxxxxxxxooooxoxxxxxxxxxoxxxxxxoxxxxxoxxxxxxxxxxxoooooxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxooxxxxxxxooxooooxxxxxxxxxxxxxxxxxxoxoxoxxx",
-"xoxxxxxooxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxoeggggggggggggggdddsrwgggggdduoopti`mffb`ituxxxxxxoxxxxxxxxxrggggggggggggggnddddddhm`vpuoooorqggipxooxooxxxxupi`ff`vuoooxxxxxxxxoxuuuruoxxxoxxoxxoorreseeoxxxxxxxxxxxxxxxourrssseooxxxoxxxxxxxxxxxxxxxxxxxxxxxoxxourrasssroxxxxxxxoouooouooxxxxxxxxxxxooxxxxxxxxoxooxourrrsssserxxxxxxxxxxxxxxxxxxxxxxxxoorrassserooxxxxxorserxxxxxxxxxxxxxxxxoxxxxxoxx",
-"xxoxoxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxooxxxxxxxrggggggggggggggjdirwgggggdjuouuti`mffm`vtuoxxxxxxxxxxoxxxxoeggggggggggggggnddddddhmctuuoxorsgggdtxxxxxxxxxxopibmm`vuxxxouoooururrrsswqsuxxxxxxxrrswggggggkoxoxxxxxxxxxxrakqggggggkrxxxxxxxxxxxxxxxxxxxxxxxxxxxorrswgggqggqexxxxrrressssslksxxxxxxxxxxxxooxxxxoxoxorraswqggggggglsuxxxxxxxxxxxxxxxxxxxxraslgggqggglkrooxorsgggtxxxxxxxxxxxxxxxxoxoxxxox",
-"oxxoxoxoxxxoxxxxxxxxxxxxxxxxxxxxxxxxxooxxxxxxxowgggggggggggggnfrwggggnddooopti`mmfm`ippoxxxxxxxxxxxxxxoxrkggggggggggggggdddddddhmituoxxurqggndxxxxxxxxxxxopv`bbiprrrrrrsssswwlggggggjcxxxxxureqgggggggggqpoxxxxxxxorakgggggggggggexxxxxxxxxxxxxxxxxxxxxxxxorrsqggggggggggwxxrsggggggggggqcxxxxxxxxxxxooxxxxxxorrewgggggggggggggqsxxxxxxxxxooxxxxxorakgggggggggggggwsareqggndxxxxxxxxxxxxxxxxxxxxoxxx",
-"xxxxxxxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxooxxsggggggggggggggrsgggggdjuxouti`mffm`ituooxoxxxxxxxxxxxxxxrlggggggggggggggddddddhfbvpuoourkgggnfxxxxxxxxxxxxutc``vewlgggggggggggggggggdtxxxxorwggggggggggggguxoxxxxorsqgggggggggggggixxxxxxxxxxxxxxxxxxxxxxorsqgggggggggggggmxrlggggggggggd`xxxxxxxxxxxxxoxxxxurelgggggggggggggggggloxxxxxxxxxxxxxxrsqggggggggggggggggggggggnmxxxxxxxxxxxxxxxxxxxxxxox",
-"xoxoxoxxxxxooxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxrggggggggggggggsgggggdduouuti`mmfm`ituoxxov`pxxxxxxuxxxxxrggggggggggggggnddddddhfctuuooreggggjcxxxxibuxxoxooticipsggggggggggggggggggjhoxxxraqggggggggggggggnootoxureggggggggggggggggvbuxxxxxxxxxxxxxxxxxxrawggggggggggggggggvrgggggggggggduxxxu`vxxxxxxxxxxorakgggggggnjddmqgggggggqoxxxxxxxooooorsggggggggnjdddjggggggggggjmxxxxxxxxxxxxxxxxoxxoxxxx",
-"xxxxxoxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxooxxowggggggggggggggggggjdpooupi`bffm`cvpoxxxxvxxxxxxxovxxxxosggggggggggggggjddddddhmcpuooraqggggdpxxuuupixxxxoouvvtpeggggggggggggggggggjboxxraqgggggggggggggggn`ucpurwgggggggggggggggggjfoxxxibfcxxxxxxxxxxrrqgggggggggndddggggweggggggggggndoxxxoxtxxxxxxxxxorsqqggggggjdhvuusgggggggggoxoxxoooxoxreggggggggjdmvoxuclggggggggjixooooooxxxxxxxxxxxxxxoxx",
-"xxoxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxoxookgggggggggggggggggjdbpuutv`bmfm`itpuxxxxxtxxxxxxxcxxxxxrwggggggggggggggdddddddhfipupraqggggndvooptttcoxxxxouupuppljjgggggggggggggggdtuiraqggggggggggggggggghtpirsggggggggggggggggggn`uuoooxtxxxxxxutpxrsggggggggggddbppvkggwwggggggggggjhtuuuuovxxxxxxtpursggggggggjdbtourkgggggggggfpuouvuvtoorqgggggggndcoouptvpwgggggggdiopttvpoouoooooxxxoooxxox",
-"xxxoxxxoxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxrggggggggggggggggjdfivptvcbffm`ivpuooxxxxpxxxxxxxixxxxirqggggggggggggggdddddddhmvprreqgggggjfvmtviii`uoxxxxxouuopibb`sggggggggggggndppaaqggggggggggggggggggdivrsgggggggggggggggggggnfttpuoovxxxxxottvrsggggggggggddmiptvilgqgggggggggggdm`bptptiooxxobvarwggggggggjdmicbraqgggggggggjmcpu``vvirsggggggggdfvpptvcbccqggggggdtutciiitoutupuooxouoouxxo",
-"xoxxxoxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxulggggggggggggggjddbcivi`bfmm`itpuooxxxxxpxxxxxxxtxxxpuaggggggggggggggnddddfmbitrrslgggggggjcuu`i``i`uoxxxxxxxxoxxcoxrggggggggggggjhvaaqgggndjwggggggggggggd`reggggnddqggggggggggggnh`ivtuovxxxxxo`creggggggggggdd`chii`ikggggggggggggndcc`iiiv`uoxovourwggggggggjdfiicfrkggggggggggnfhvpiooxvrqggggggggdtivii``fbbsggggggdivv`civvuxtxuxxoxuoooooxx",
-"xxoxxxoxooxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxokgggggggggggggnddhfbcc`mmfm`cvpuoooxxxxxtxxxxxxovoxxvusggggggggggggggsrarrrssskwggggggggggdvut``bbc`uooxxxxxxxxxxvxxrggggggggggggdmerlgggjdbtaggggggggggggdsaqgggddbutkgggggggggggndfmcituixxvxxiursggggggggggjdc``b`mmmsggggggggggggjdbmmmb`c`puooturwgggggggggdmbccbcrgggggggggggndmcicpootegggggggggdtccbbfmhmmclggggnd`c`mb`iiuopxuxxoxuoooooxx",
-"oxxxoxxxxxoxxxoxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxeggggggggggggggdddhmmbmmfm`itpuooxxxxxxxtxxxxxxxcxooorlggggggggggggggggggggggggggggggggggndupmbbmbicuoxxxxxxxxxxxvoorgggggggggggndbrwgggdd`purgggggggggggnbrlgggddpoxasgggggggggggjdhhm`vpioxvxxirsggggggggggjdhic`mfhj`sggggggggggggdhhhdhhmc`pooxrrwgggggggggdjpfciccsgggggggggggndhb``puoasgggggggggdimbfhhhhmm`sggggndmmmffbcvuotxoxxoxuoxoxxxx",
-"xxxxxoxxxxxxoxxoxxxxxxxxxxxxxxxxxxxxxxxoxxoxxxxxxuqgggggggggggggjddhhffhfmbitpoxxoxxxxxxxpxxxxxxxcuoxxrgggggggggggggggggggggggggggggggggggjfff`bmmhhfmixxxxxxxxxvbmmesgggggggggggjdrsgggddffptagggggggggggnrsgggddvuoorkgggggggggggjdddhmffmmmmxxraqggggggggggdmcfjhhhddisggggggggggggdddddhhdhfmmoorwgggggggggndvtifjhbsgggggggggggndhhfhmptewgggggggggjhhdjhhjhff`eggggjdhhjdhmbcutpxuoxpxxouoooxo",
-"xoxoxxxoxoxxxxoxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxokgggggggggggggnddddhhfmbcvpooooooxxxxxxvtxxxxxxxioxregggggggggggggggggggggggggggggggggggdivcbfff`vpuxxxxxxxxxxxxxxrkgggggggggggdeaggnddmitursgggggggggggseggndd`vptirlgggggggggggddddhfbipoxxourqggggggggggjdibmhhddhhslgggggggggggjddddddhm`tuxorsggggggggggdfvc`mhhfsgggggggggggdddhfmcturwgggggggggghhhddhm`ivtalgggjhhhdhhmituoxoxxxxxxxxxxxxx",
-"xxxxoxxxxoxxxoxoxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxeggggggggggggggddddhhfbitpuoxxxxoxxxxxxuvuxxxxxoooxrkggggggggggggggjdjjjjnnggggggggggggndiibmhfm`tpoxxxxxxxxxxxxxxuwggggggggggnmrlggddhbiturkgggggggggggrqggjdh`iptvaggggggggggggdddddhmctoxxorwggggggggggndb`fhdddhhfawgggggggggggjddddddhmctuoraggggggggggndicbffhjh`ggggggggggnddddhf`iprwggggggggggndddhfbitpuukgggdhhddhhbipuoxxooxxxxxxxoxox",
-"oxoxxoxoxxoxxxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxuqgggggggggggggjddddfmcvpooxxxxxoxxxxxxxxxxxxxxxxxxrlggggggggggggggddddddddjjjgggggggggnjibfhhhmctuxxxxxxxxxxxxxxxrgggggggggggnrsggjdjf`vptrlggggggggggkkggjddfbitpasgggggggggggndddddhm`tpoxrsgggggggggggdhbfhhdddhfbrqgggggggggggdddddddfbvpuorqggggggggggdmcbfhddhfmwgggggggggddddddfmiprwgggggggggggdddhmcvpuoosgggd`fhddfbipoooxxxxxxoxxxxxxx",
-"xxxoxxxxoxxxxxxoxoxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxuwgggggggggggggndddhf`vpuoxoxxxxxxxxxxoxoxxxxxxxooorggggggggggggggndddddddfbcv`qgggggggjhmfhjdhbipoxxxxxxxxxxxxxxosgggggggggggaeggnddhmcvppagggggggggggsggndddfbivtrlgggggggggggjdddddhfcvpooaqggggggggggndmfhddddhfbvrgggggggggggnddddddhf`vuorkggggggggggndbmfhddhhmcvqgggggggjddddddhmctpwggggggggggggddhmituooooggndcmhhhfbvpuxxoxxoxxxxxoxxox",
-"oxxxxxoxxxoxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxraqggggggggggggggdddhmituoxxxxxxxxxxxxxxoxoxxxxxxxorsggggggggggggggjddddddhhm`cvvwggggggdhhdddhfbipoxxxxxxxxxxxxxxrkgggggggggggrqggdddfbivtrsgggggggggglqggdddhf`iveaggggggggggggddddddhmcvuorkgggggggggggjdfhdddddhmcasgggggggggggjddddddhmituragggggggggggjjmhhdddhf`ipobnnnnjddddddddhmctusggggggggggggfdhmipuoooxoddhibfhhf`vpooxoxxxxxxxxxxxxx",
-"xxoxxxoxoxxxxxxooxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxorwgggggggggggggggjddhbcpoxxxxxxxxxxxxoxxxoxxoxxxxxxuwggggggggggggggddddddddhfbb``sgggggndhddddhf`vuxxxxxxxxxxxxxxxrlggggggggggswggjddhm`vtvrwggggggggggqggnddddfb`ctsggggggggggggddddddhfcturegggggggggggndhhddddhhmcvpsgggggggggggdddddddhbiporlgggggggggggdfhhdddhhbipoxxobffjddddddddhmcpueggggggggggggghhmctoxxxxxouut`mhhm`tuooxxxoxxoxxxxxxxx",
-"xxxoxxxxxoxoxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxrrwggggggggggggggggjddhmctoxxxxxxxxxxxxoxxxxoxoxxxxxxrqgggggggggggggnddddddddhfmmbbcwggggjddddddhmctuxxxxxxxxxxxxxxxrgggggggggggsggndddhm`ciirgggggggggggggnddddhfm`crlgggggggggggjddddddhmiturlgggggggggggjdhdddddhfbiprlggggggggggnddddddhf`vpregggggggggggjdhhddddhmcvpuoxootibfdddddddhmiporgggggggggggggghf`vuoxxoxooutibffmcvuooxxoxxxxxoxoxoxx",
-"xoxxxxoxxxxxxoxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxorwggggggggggggggggggddhf`vuxxxxxxxxoxxxxxxxxxxxxxxxxxaggggggggggggggndddddddhfmbbbbckggggdddddddfbituxxxxxxxxxxxxxxosggggggggggllggddddhmciceegggggggggggggjdddddfmbiaggggggggggggjddddddhbipregggggggggggndjddddddhbitprgggggggggggjddddddhfcturlgggggggggggjdhdddddfbituxoxootibfhdddddhfbipookgggggggggggggghbipuxxoxxxopv`mmbituxooxxxoxoxxxxxxxx",
-"xxxxxxxxoxoxxxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxorwgggggggggggggggggggdddf`vuoxxxxopxoxxxxxxxxoxxxxxxxusggggggggggggggjddddddhdhbcii`vsggggddddddhdfipoxxxxxxxxxxxxxxrwggggggggggqggjdddhfb`ccakggggggggggggndddddhffmakgggggggggggnddddddhf`iprlgggggggggggjdddddddhm`vpuegggggggggggdddddddhbcpregggggggggggndhdddddhm`tpooxoxupv`mhddddhhbcvuoxrggggggggggggggqmcvpoxxoxooutc`b`vpuoxxoxxxxxxxxxxoxx",
-"xxoxxoxxxxxoxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxrsgggggmlgggggggggggggnddhmcpoxxxx`uxxoxxxxxxxxxxxxxxvrwggggggggggggggddddddddb`itttiasgggnddddddhmmtpoxxxxxxxxxxxxxxrqgggggggggggggddddhfb``irqggggggggggggjdddddhhj`rqgggggggggggndddddddf`vreggggggggggggddddddddhbiturkgggggggggggdddddddfbvprkgggggggggggndddddddfbcpuoxxxxxutibffhhhhm`vpuoxokggggggggggggggmbipuoxoxooupv`cctpoooxoxxoxoxoxoxxxx",
-"oxxxxxxoxoxxxxxoxxxoxxxxxxxxxxxxxxxxxxxxxxxorsgggggjhkgggggggggggggnddhm`tuxxxx`xooxuvtxxxpuxotuxucrggggggggggggggnddddddhdmctpuiiusgggjhfhdddhmbpuoxxxxxxxxtutxtuegggggggggggggndddddhbb`eeggggggggggggnddddddhhhieggggggggggggdddddddhmctrlgggggggggggndddddddhm`vuorqggggggggggjddddddhfcvurggggggggggggjddddddhf`vpoxxxxxoouvi`mmmmb`vtuoxxxrqggggggggggggggf`vpooxoxooptvivpuoxxxxxxxxxxxxxxoxx",
-"xxxoxxxxxoxxxxxxoxxxoxxxxxxxxxxxxxxxxxxxxxorsgggggjdtaggggggggggggggdddfbipoxxupxooxivtixxpiouvvoueeggggggggggggggndddddddhmcpuov`osgggdmffhdhfbbpoooxxxxxxo`ii`tesgggggggggggggdddddhdfb`akggggggggggggjddddddhhmakggggggggggggdddddddfbiraggggggggggggddddddddhbituuegggggggggggjddddddhmctrsggggggggggggdddddddhm`tuoxxxxxxouutvccccivpuoxxxxxsgggggggggggggggfcvpooxxxooupppuooxxoxxxoxooxoxxxox",
-"xoxxxxxxxxoxoxxxxxxxxxoxxxxxxxxxxxxxxxxxxxrsgggggjdvxrlgggggggggggggjddhbctoxxtxxxoocm`ixxxvxxxvxxakggggggggggggggjddddddhfcpuooovusgggdvbbhhhf``pxxxcmbbbixvvxvxrlggggggggggggjddddddhdbcrqgggggggggggnddddddddf`rqgggggggggggjdddddddf`irkggggggggggggdddddddhf`vporkgggggggggggdddddddfbvprwgggggggggggndddddddf`vtuoxxxxxxxooopttvvtpuoxxxxxxxwgggggggggggggggmctuooxoxoouuuuoxxxxoxxxxxxxxoxxxx",
-"xxoxoxoxxxxxxxxoxxxxxxoxxxxxxxxxxxxxxxxxoraqggggjdvxookggggggggggggggddhfcvuxxvxxxxvpoxixxoioxxtxxrlggggggggggggggddddddhffvpoooxvokggjdpb`fhhmc`uxxxxoooxxxttxtorgggggggggggggjdddddhhhbveggggggggggggjdddddddhmseggggggggggggjddddddhm`trqgggggggggggjdddddddhmctuorqggggggggggnddddddhf`vurggggggggggggnddddddhm`touxxxxxxxxxoooouuuuoooxxxxxxxxqggggggggggggggj`ctuooxoxxoooxxxxxxxoxoxoxoxxoxxx",
-"oxxxxxxxxxxxxxxxxxxxxxoxoxxxxxxxxxxxxxxxraqggggndcxoopsggggggggggggggdddfbipuxutxxxixxu`xxoixovvxorggggggggggggggnddddddhfmvpoxxxvxeqgjboccmffbicuruxxooxooovtxvosggggggggggggndddddddhm`rkggggggggggggddddddddhbakgggggggggggndddddddhmiaeggggggggggggdddddddhf`vpouegggggggggggjddddddhm`treggggggggggggjddddddhbitoxxxxxxxxxxxxxxoooooooxxxxxxxxrqggggggggggggggh`ituooxxxxxxxxxxxxxxoxxxxxxxxoxx",
-"xxoxxoxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxraqggggndmououvvqgggggggggggggjddfmctuxx`xxxobmviixoumbpmprsggggggggggggggjdddddddhhf`oxtmbmb`mdhffhhmmhfmaslkxxxxxopmixbrkggggggggggggjdddddddhmcrlgggggggggggjjddddddhfcrqgggggggggggnddddddhf`vrkggggggggggggdddddddhmctporkgggggggggggdddddddhbctusggggggggggggdddddddfbvuuoxxxxxxxxxxxxxxoxoxxxoxxxxxxxxsggggggggggggggnm`vpuoxoxxxxoxxxxxxxxxoxoxoxxxox",
-"oxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxuaqggggndmooupvcbsgggggggggggggnddhmcvpoxpuxxxxxxxxxxxxoxxxrwggggggggggggggdddddddhbipuxxxxxxxxxxxutibfbctraqggbxxxxxxooxxrqggggggggggggdddddddhfbtaggggggggggggddddddddhbeeggggggggggggdddddddhm`vrlgggggggggggnddddddhh`ipooagggggggggggnddddddhf`vprwggggggggggggddddddhm`vooxxxxxxxxxxxxxxxxxxxxxoxxxxxxxookgggggggggggggghmcvpoxxxoxxxoxxxxxxoxxxxxxxxxxx",
-"xxoxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxurwgggggdmxoupvc`msggggggggggggggdddf`vpuooxxxxxxxxxxxxxxxxorqggggggggggggggddddddhf`vuoxxxxxxxxxxxoti`m`iprwggnduxxxxxxxxuaggggggggggggjdddddddhm`asgggggggggggndddddddhf`akggggggggggggdddddddhbiprggggggggggggjddddddhfcvuorsgggggggggggjddddddhfcvurwggggggggggggddddddhmctuxxoxxxxxxxxxxxxxxxxxxxxxoxoxxxxxolgggggggggggggjfbctuooxxxxxxxxxxxxxxxoxxxxoxxx",
-"oxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxurwggggndhxooptcbmfcqgggggggggggggjdhhbituooxxxxxxxxxxxxxxxxoeggggggggggggggnddddddhmctuoxxxxxxxxxxxuti`b`vrsgggjfxxxxxxoxxusggggggggggggddddddddfbirlgggggggggggjddddddjhbirlgggggggggggjdddddddfbvreggggggggggggdddddddhbipuurqgggggggggggdddddddhbitorggggggggggggnddddddhbipoxoxxxxxxxoxxxxxxxxxxxxxxxoxxxxxooulgggggggggggggdf`vtuxxxxxxxxxoxxxxxxxxoxxxoxx",
-"xxoxxoxxxxxxxxxxxxxxxxxxxxxxxxoxxxxurwgggggdjuxoutc`mfmbsgggggggggggggnddhmituooxxxxxxxxxxxxxxxxrsggggggggggggggjddddddhmitooxxxxxxxxxxoopic`craqgggjixxxooxxoorwggggggggggggdddddddhm`tagggggggggggnddddddjhm`vaggggggggggggdddddddhm`tusgggggggggggndddddddf`iuursggggggggggggdddddddfbiporggggggggggggndddddhf`vpoxxoxxxxxxxxxxxxxxxxxuerxxxoxxxxxouaqggggggggggggdhm`vuooxxxxxxxxxxxxxoxxxxoxxox",
-"oxxxoxxoxxxxxxxxxxxxxxxxxxxxoxxxxxorwgggggdhuouupibmfmbcaggggggggggggggddhf`tpooooxxxxxxxxxoxxxxrwggggggggggggggdddddddf`ipxxxxxxxxxxxxoopticarlggggdpxxxououoorggggggggggggjdddddddhbiasgggggggggggnddddddjfbirsggggggggggggdddddmdhmctrkgggggggggggnddddddhmcvuurqgggggggggggnddddddhfcvporggggggggggggndddddhmcvuoxxxxxxxoxxxxxxxxxxxxaggkxxxooxxxxousggggggggggggjdhbctuoxxxxxxxxxoxxxxxxxxxxxxx",
-"xxoxxxxoxxxxxxxxxxxxxxxxxxxxoxxxxorkgggggjduooutv`bfmmcvaqgggggggggggggjddfbipoxxxxxxxxxxxxxxooorggggggggggggggnddddddhf`tuoxxxxxxxxxxxoooptprwggggjjxooouppuorsggggggggggggdddddddhf`trwgggggggggggddddddjhf`vrwgggggggggggjddddhrs``ipuwgggggggggggjddddddhbctorsggggggggggggjdddddmmmituorggggggggggggndddddhmipuoxxxxxxrsqaxxxxxxxxxxegggmxxxoxoxxxouwgggggggggggndhf`ipuxxxxxxxxxxxxxxxxxxoxxxx",
-"xxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxoorsgggggjdvouppi`bfmmcvprkgggggggggggggjddhm`tuoxxxxxxxxoxxoxoxrsggggggggggggggnddddddhmctuxxxxxxxxoxxxooourrwgggggd`xoupttpporkgggggggggggndddddddhmctrggggggggggggddddddjhmctrqgggggggggggdddddaegg`turwgggggggggggjdddddhf`vpraqggggggggggggdddddjrssiuxxrggggggggggggndddddhbipuxxxxxxraqqgkxxxxxxxxosgggdxxxxxxoxoourqggggggggggnddhmctuoxxxxxxxxxxxxxoxxxxoxox",
-"xoxxxoxxxxxxxxxxxxxxxxxxxxxxxxxorsgggggjdvoouti`mfmmcipoosggggggggggggggddhf`vpooxxxxxxxoooxxoxukggggggggggggggjddddddhbiuoxxxxxxxxxxoxooxurwggggggdpouptiivpurlgggggggggggjddddddhh`irsgggggggggggjddddddjf`iaaggggggggggggdddd`rgggjcuuwgggggggggggjdddddhf`vprkgglggggggggggdddddeaggluxxuqggggggggggggdddddhbvuuxxxxxurlgggjbxxxxxxxokgggjoxxoxxxxoxuusggggggggggnddhfbipooxxxxxxxxxxxxxxxoxxxxx",
-"xxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxrsgggggjdvoouticmmfmcvtuxorggggggggggggggdddhbipuxxxxxxoooxoxxoxrlggggggggggggggdddddddf`vuooxxxxxxxxxxxxxrrwggggggndxopti``ituaggggggggggggdddddddhm`trwgggggggggggdddddddhf`vrsgggggggggggndddhrkggndiorwgggggggggggjdddddhmctrsggkggggggggggnddddcrqggjbxxowggggggggggggdddddf`iuxxxxxorwgggndvxxxxxxxrwgggnvoxoooxxoooorqgggggggggndddhmctuxxxxxxxxxxxxxooxxxxoxx",
-"xoxoxxxoxoxxxxxxxxxxxxxxxxxxxorsgggggndbxuupi`bfmm`ipuoxxulgggggggggggggnddhmctpuxoxxxoxooxxxxuaggggggggggggggnddddddhf`vuoxxxoxxxvbpoxoraqgggggggjmoptc`b`itreggggggggggggdddddddhbiprggggggggggggdddddddhbitrkgggggggggggjdddeegggdmuoowgggggggggggjdddddhbiraqggsggggggggggjdddmrwggndcxxokggggggggggggndddhh`vpxxxxxrsggggdhxxxxxxxxrlggggmuuuuuoooxoousgggggggggjdddhf`vpoxxxxxxxxxxxxxxoxxxxox",
-"xxxxxoxxuxxxxxxxxxxxxxxxxxxuorsggggggdfooutvcbffm`ituxxxxowggggggggggggggddhf`vpooxxoxxxoxooxxukggggggggggggggjddddddhmctuooxxxxxxxxvorrkgggggggggdvptv`fm`vprlgggggggggggjddddddhf`vregggggggggggnddddddjfbiprwgggggggggggdddaaqggjdvuookggggggggggggdddddf`raqggwkggggggggggjddfrsgggdfoxxxegggggggggggggdddhf`vuxxxorsggggjjoxxxxxooorgggggjupttppoooxooegggggggggdddddfbipoxxxxxxxxxxxxxxxoxoxxx",
-"xoxoxxxxuxxxxxoooxxxxuoxxxxareggggggnduvppicbffm`iiipxxxprsggggggggggggggnddfbituoxxotpvovuoxorlggggggggggggggjddddddhbitoxutvxxxoooarelgggggggggndivi`fhhm`urggggggggggggjddddddhfctrkgggggggggggjddddddhf`vprlgggggggggggddaaqggndbuooxsggggggggggggqdddh`aaqggnrwggggggggggjdfrsgggjdtoxxxoqggggggggggggqdddf`tuoxurwggggjdvxxouuuuuorggggggvtivvpuoooxorgggggggggdddddhbctuoxxxxxxoxoxxoxxxxxoxx",
-"xxxxxoxooxxxxuuutxxotuptpxurwgggggggnfbctvcbffmbivivipxxttsggggggggggggggghdhmctuoxxociicvcxxregggggggggggggggjdddddhf`vpuxvvvixxourelgggggggggggjhcf`mhhfbireggggggggggggdddddddhbiprqgggggggggggdddddddhbiturggggggggggggwraqggndhtuoxurgggggggggggggwkcrrsqggndrggggggggggglsrsgggjd`uooooukggggggggggggglbmf`turralggggndcxoouptvtpuegggggghic`ituooooorggggggggjdddddhmctuxxxxxxxxxxoxxxoxoxxxx",
-"xoxxxxxoxxxxxpooxxxpuupuvrawgggggggggmpivcbffmbivp`bitxoorsgggggggggggggggqhhfffmbbixptxvovorrlgggggggggggggggjdddddddhmtuxi`cvurrslgggggggggggggdfc`mfhhmcprkgggggggggggnddddddhf`vregggggggggggnddddddhhbvpurgggggggggggggwggggjd`tuouptwggggggggggggggwwgggggdhrggggggggggggwlgggndfpuxoupptqgggggggggggggqserraelgggggndmoooutvccvtrsggggggq`bb`vuooooregggggggnddddddhfctuoxxxxxxxxxxxxxxxxoxox",
-"xxoxoxooxxxxxxxopxxtuuprreqggggggggggktccbfffbcvpioxotoorrlggggggggggggggggqk``ipoxxxtpxvoprrwggggggggggggggggqbfdddhbituoprrraswgggggggggggggggndibhhhhh`vprlgggggggggggjddddddhmctrsgggggggggggjddddddhm`vuurgggggggggggggggggjdmvpuoptisggggggggggggggggggggdhurggggggggggggggggndhipuoupvvvsgggggggggggggggggggggggggndmooxupic``ctrsgggggggqbmbcpoxoorlgggggggjddddddhm`tpoxxxxxxxxxoxoxxoxxxxx",
-"xxxxxxxooxxxuoxxouxotrrewggggggggggggglsrvffmcvpuixrrrraslggggggggggggggggggglsaruxxxppurrasqggggggggggggggggggqksrrrrrresskwqggggggggggggggggggnj`mhddhh`vpaggggggggggggdddddddhbitrlgggggggggggdddddddhbipooulgggggggggggggggjdh`vpuuvicclggggggggggggggggggjdtxulgggggggggggggggdd`vppppiicivkgggggggggggggggggggggggndmxxoptvcbb`ctrwggggggggwbm`tuxursgggggggjdddddddhfctuoxxxxoxxxxxxxoxxxxoxx",
-"xoxxoxoxuoxxouppuxxxoeqggggggggggggggggggqnm`ipoxt`rwqggggggggggggggggggggggggggglexu`vrwgggggggggggggggggggggggggggggggggggggggggggggggggggggggdhhddhdhfmmesgggggggggggnddddddhf`vragggggggggggndddddddfbvuoxokggggggggggggggjddm`vpptic`isqggggggggggggggggjdixxosggggggggggggggddfcvpppvi`citpkgggggggggggggggggggggjdmxxxppvc`mb`vtrwgggggggggletarrakgggggggjdhhdddddhmctoooxxxxxxxxxoxxoxoxxxx",
-"xxoxxxxxooxoxxxxxxxxosggggggggggggggggggggghctuoxxxrggggggggggggggggggggggggggggggncxxxrggggggggggggggggggggggggggggggggggggggggggggggggggggggggdhhhddhhbiprwgggggggggggjddddddhmctrkgggggggggggjddddddhfcvpoxxuqggggggggggggjddhmcvttic``ipsgggggggggggggggdd`puoupqgggggggggggnddjf`vttvc``cvpuo`ggggggggggggggggggnddioouupvc`mb`iturqggggggggggggwwlggggggggjdfmhdddddfbitooxxxxxxxoxxxxxxxxoxox",
-"oxxxxxoxxoxxxxxxxxxxxagggggggggggggggggggggdipoxxxxxggggggggggggggggggggggggggggggnmxxxxgggggggggggggggggggggggggggggggggggggggggggggggggggggggndhddddhf`vpoggggggggggggdddddddhmitukgggggggggggdddddddhmctuoxoxrggggggggggjddddhf`ivic``cvpucggggggggggggjddbivtptvcggggggggggjdddhf`ivic```ituooucnggggggggggggggnjdhtooupticbmm`cvporggggjjjnggggggggggggggjdj`imhddddhf`vpooxxoxxxxxxoxxxxoxxxxx",
-"xxoxoxxxxxxxxxxxxxxxxxtdddddddddddddddddddddipoxxxxxxddddddddddddddddddddddddddddddfooxxxdddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddhmctpooddddddddddddddddddf`vpoxmdddddddddddddddddfbipooxxoxunngggnnjddddddhhbb`bb`cvpuoopnnggggggnjdddhf`ciicc`bnggggggnddddddhm````b`itpoooouthjnggggggggnnjddctttttvccbmbbcvpuuugggdjccmjjnggggggggnjdd`ppimhddddhbctuooxxxxoxxxxxxxxxxxoxxx",
-"oxxxxoxoxoxxxxxxxxxxxxxxxoooooppvc`mhdddddhmctuoxxxxxxxxxxooouppibfdddddddddddddfbcvpuoooxoxxooxoupvcbfjddddddddddddf`ipuuoooooouuppptvvi``mfhhdddddddhbitooxxoooouv`fjdddddddhfcvuoxxxxxoupcmhdddddddhm`vuooxxxoxo`fddddddddddddhfmmbb`ituuxuoubjjjjjddddddjhfmbbbbmbbfjjjdddddddddhfmbbb`cvpuooxoupi`hddjjjjdddddfbcciicc`bmmmbcvtuoooejdhpupcmhdddjjjjdddmcoouvcfhdddhm`ipuoxxxxxxxxxxxxxxxxxxxox",
-"xxoxxxxoxxoxxxxxxxxxxxoxxxoouptvc`mhhdddddhmbivppooxxxxxxooupptvcbhhddddddddddddhfbcivppuuooooooppvi`fhdddddddddddddfmcvtppupppppttvvic`bmfhhddddddddhf`vpuoxxxxoouv`fhdddddddhmctuxxxxxxoptcmhdddddddhmctuoxxxxxoooui`fddddddddddhffb`ivpooxxuutcbhddddddddddhhfffmm`cvvmfhdddddddddhhfmbcvpuoxxxxoutibfhdddddddddhhmmmbmmfffmbcvtuoxxouvvtxuvcmhdddhhmb`uuuooutibfhdhhfbituooxoxoxxxxxxxxxxxxxxxxx",
-"xxxxxoxxxxxxxxxxxxxxoxxxxxoupti`bfhhdddddddfm`citpuxxxxxxuuptvccbfhddddddddddddddhfm`civtuuoxooptv`bmhhdddddddddddddhfm`civvvvviiic``bmmfhhhdddddddddhm`tuooooxxoopibfdddddddhfbvpoxxxxxoopv`fhddddddhhbitoxxxooxxxouv`mhdddddddddhhmbctuooxoxoouv`mhddddddddddjhhfm`ivtpv`mhdddddddddhfb`ituuxxxxxooptcbfhddddddddddhhhfhhffmbcvupuxooxoxxxouv`fhdjdhfb`ittppppicmhhdhfbcvuuxxxxxxxxxxxxxxxxxoxxoxx",
-"xoxxxxxxoxoxoxxxxxxxxxxxxxxuticbmhhdhddhdhhhfmb`itpoxxxxoupvicbbmhhdddddddddddhdhhhfmb`citpoouuvc`bffhhddddddddddhdhhhfmb```````bbbbmffhhhdhhddddddhhfbipuxxxxxooupibfhdddddhhm`vuoxxxxxootv`fhdddddhhm`vpooxxxoxxxoupcbhhddddddhhhmbivpuxoxxxoouti`mhdddddddddhhfm`ituuptcbhhddddddhhfb`vppooxoxxxxoupvcbmhhdddddddddhdhhhfmbivpuxuxxooxoxoopt`mhhhhhhfb`civvvc`mfhhhmbctpuoxoxxxxxxxxxxxxxxxxxxxxx",
-"xxoxxxxxxxxxxxxxxxxxxxxxxoouti`mmffhfhfhhhffmmb`cvpoxxxxoupvc`bmmffffffhfhffhfhfhffmmbb`ivpuoupvc`bmffffffhffhfhhhhhffmmbb`b`bbbbbmmmmmffffhffffffhffbcvpoxxxoxxooti`mfffffhfmbitpxxxxxxxupv`bffffffff`cpuooxoxxoxxoopv`mhhhdhdhhfm`ituoxoxxxoxoopti`mfhddddhdhhfm`ituooopvcmhhddddhhfb`vtuoooxxxxxoooopti`mfhdhddddhdhhhfmbcivpuoxxxxxoxoxoopv`mfhfffmmmm```c`bbmffmm`itpooxoxoooxxxxxxxxxxxxoxxoxx",
-"xxxxoxxxxxxxxxoxxxxxxxxxxxoutvc```bbbbbbbbbb```civpoxxxxxupvi`c```bbbbbbbbbbbbbbbb`bb`ccitpooouvic```bbbb`bb`bbbbbbb`b````c`c```````b``mbbbbbbmmbbb``ivpuxxxxxxoxopvc`bbbbb```itpoxxxxxxxouti``bbbbb``ivpoxooxxxoxxouupicbfffffmb`cvtuooxxxxxxxooupti`bmffhhhffm`cvtpoxxoopicmffhfhfb`cvpuoxxxxoxxxxxoouutvc`bmffhfhhhffmb`ivtuuxxxxxxxxxxxouptcbbb````bbbbbbb`bmmmb`cvtuooxxxxxxoxxxxoxxxxxxxxxxxox",
-"xxoxxxoxxxxxxxxxxxxxxxxxxxoouttiiiviivivvvvvviivtpupxxxxoouptvvivivvvviiiviiviiiiviiiivvtpuuoot`tvviiivvvivmbivvvviiiciivivvcvvv`mcmivi`ivivvii`iiivvtpuooxxxxxoooupbcvvvvivvvtpoxxxxxxxoou`bvvvviicbttpupcucpoxoxxxooupvic````civtpuoxxxxxxxvtxxxoptvi`bbbbb``citpovcpxxoupvi`bmb``cvppooxxxxxxxxxxpcxxouptvc``mbmbbb``civtpuooxxxxxxxxxxxxxuticciivvviccc```````ccitpuooxxxxxxxxooxxxoxxxxoxxoxxxx",
-"xxxxoxxxxxxxoxxxxxxxxxxxxxxxouuppppppppppppuupppuuiuxxxxxxouuuupuupppupppppuppuptpppppppuoooooovuupppppppptftppuppuuctpppppvipppvbifpppuippupppippppuuoxxxxxxxxxooouuippppuuvuuuoxxxxxxxxooovuppuuvtp`vooomompxxoxoxoooupttvvvvttpuuooxxxxxxxxpxxxxxuitviiiiivvtpuuooxpxxxooptviiiivtpuooxxxxxxxxxxxxtxooxouutvvibiiiivvtppooxxxxxxxxxxxxxxxooutvvtppppptvviiiiivvttppuoxoxxxxxxxxxxxxxxooxxxxxxoxxx",
-"xoxxxxoxxxxxxxxxxxxxxxxxxxxxoooxuouoooouuooxoooooxixxxxotpoxotuptpooppottoooxutvoooppptuoooxututooooooooooviooooooouioouuouioooot`uboooovuooxoouvoooooxxxxxxuuoptooootpvooopitttxxpopxuuxxxotoooootooooxxxmx`oxxxxxxxoxoouupppuuuooooxxxxxxxxxpopoxouivvivtvvvtptooxxxpxxxoxouuppvvvtupxxxxupoxxooptopxxootpouuppcttppppuuooxxxxxxxxxxxxxxxxxxopuuuuoooouupppttpppuuoooxxxxxxxxxxxxxxxxxxxoxxxoxxxox",
-"xxoxxxxxoxxxxxxxxxxxxxxxxxxxxoooxxooxoxxoxxxxoxxouuxxxxppttxxtiipvtouictpcoxtiptcoopctttuxxttpicoooooxoxoovuxoxxoxxupoooooovxooooixioxxoxvxxxxxxvxxxxxxxxxxxuiitpcxxx`ptixxuiptuxxpcpittpxxxpxxxxxucpuxxxxcxvxxoxxxxxxxxxoooooooooxxxxxxxxxxxxvtttuxoittvuutcvctttxxxxpxxxxxxxouotctctptxxtvpipoxptpiioxtvppcuoooppouoooooxxxxxxxxxxxxxxxxxxxxouoooxoxooxoooououuooooxoxxxxxxxxxxxxxxxooxxxoxxxxoxxx",
-"xxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxpxxxxxtcvtxxxtxxxtxxtoxoopovpppvixxpxxopoxtxxxtxxxxxxoxxxxxxxxxoxopxxxooxopoxxxxxxxxoxxxtoxxxxxotxxxxxxxxxxxtxxxopxxpxxpxxxpxxxxxxixpxxpxxxpxxxxxxxxtpxxxxoxxxxoxxxxxxoxxoxxxxxxoxoxxxxxxxxxxpxxxpxxpxooooocxtxxpxxxxpxxxxciccipxixpxxuxuoxxxpxxtxxxtxxvppptvxxxxtxxxoxoxxxxxxxxxxxxxxxxxxoxxxooxoxxxxxoooxoxoxooooxxxxxxxxxxxxxxxoxxxoxoxxoxoxxoxx",
-"xoxoxxoxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxpxxxxpuxxtxxxtxxxtxxtxxxopxcpptpuxopxxxpxxpxxxpxoxxxxxxxxxxxxxxxxopxxxxxoxpxxxxxxxxxoxxxovxxxxxxixxxxxxxxxxxtxxxopxxpxxpxxxpxxxxxxixpxxpxxxpxxxxxoxxopxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxpxxxtxxpxoxoxxixpxxpoxoopxxxxxxxxxoxixpxxuxpxxxxpxxpxxxpxxipppppxxxxpxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxox",
-"xxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxuxxxtxxovxxxcoxotxxvtxovoxttxxxoxxpoxxpxxvxxucxxxxxxxxxxxxxxxxxxxopxxooxotxxxxxxoxxxxxoxtxxxxxxuoxxxxuvxxxxvtxovxxxpxxuxxxtxxxoxxvxpxxpxxxuxxxxxvvttxxxxoxxxxxxxxxxoxxxxxxxxxxoiuxxxxxxxxxxxpxxxpxxpoxoooxixpxxpoxxxpxxxxxxxxxxxixuxxuxxvoxutxxvoxucxxttxxxoxxxtxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxoxxxxxxxxxxxxxxoxxxxxxxxxxxxoxxxxxoxxoxxoxxxxxx",
-"xoxoxoxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxvxxxxiiptpxxptitxxxuuivooxxuiipoxtipxtixxxtituixxxooxxxxxxxxxxxxxxvxxxooxtoxxxxxooxxoxxxotxxxxxxvxxxxuvxxxxuuivoxxiixuivxxxvivuxiixpuxixpiivvuxxxxuxxxxxxxxxxxoxoxxoxxxxxxxxxxoiuxxxxxxxxxxpiuxiiuxxtiipotiuutxtuoiiiitxxxxxxxxtiuupxpoxxvvtxxxxvituixxovipxooxvxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxooxxoxxxxxxxxxxxxxxxoxxxxxxxxxxxxxoxxxxoxxoxxxoxoxx",
-"xxxxxxoxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxooxxxxxxxxxxpxxxxxxpxxxxxxoxxxxoxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxuuxoxxxxtxxxxxxxxxxoxxxuxxxxxxoxxxxxxxxxxpxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxuxxxxxoxoxxxxoxxxxxxxxxxxxxxoxxxxoxxxxxxxxxxxxxxxoxoxoxxxxxxxxxoxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxtoxxxxxxxxxxxxxxxxxxxxxxxxoxoxxxoxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxoxoxoxxxxxxxxox",
-"xxoxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxvivxxxxpivoxxxxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxoxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxpiioxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxoxxxxx",
-"oxxxxoxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxoxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxoxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxoxxxoxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxoxoxxoxxxxxxxx",
-"xxoxxxxxxooxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxoxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxoxxoxxxxoxx",
-"oxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxoxxxxoxxxxxxxxxxxxxxxooxxxxxxxxxxxxxxxxxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxoxxxxoxxxoxxxxx",
-"xxoxxxxoxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxoxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxoxxxxxxxoxxxxoxox",
-"xxxoxoxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxoxxxxxxxxxxxxxxxxoxxxxxoxxxxxxxxxoxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxoxoxxxxxxxxxxxxxoxxxxxooxxxxxxxxxxxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxoxxxxxxxxxxxxxxoxxxxoxxxxxxxxxx",
-"xoxxxxoxxooxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxoxxxxxxxxxxxxxxoxooxxxxxxxxxxxxxouxooxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxoxxooxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxoxxxxxxxxxxxxxxxoxoxxoxoxoxxxox",
-"xxxxoxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxoxxxxxxxxxxxxxxxxxxxoxuxxxvpppxxxpxxxxxxpoxxxxxxxxxxxxxxxxxxxopxxxxxxxxxxxxxxxxxxxxxxpuxxxxxxpxxxxxupopxxxxxxxxxxxxxxxxxxxxxxxxoxoxxxootuxxxxxxxxxxxoooxoxxoxxtpxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxuuxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxoxoxxxxxoxxxxxxxxxxxxxoxxxoxxxxxxxxxxx",
-"xxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxooxoxoxxxxxxxxxxxxxxtoxxxtpttxxxooxxxxxxpxxxxxxxxxxxxxxxxxxxxuxxxxxxxoxxxxxxxxxxxxxxxuxxxxxuxxvxxxuvuixxxxxxxxxxxxxxxxxxxxxxoxoxxoxxxoxuxxxxxxoxxxxxxxxoxxxxxxuxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxuxxxxxxxxxxuxxxxxxxuxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxoxoxoxxxoxxxxxxxxxxxoxxoxxxoxxoxxxxx",
-"oxxoxoxxxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxoxxxxxoxxxxxxxxxxxxpoxoxtuptxxxxpxxxxxxpooxxxxxxxxxxxxuuoxxxuxoxxxxupooxxxoooxoxxxxxoxxxxxuxxxxxxutxvxxxxxxxxxxxxxxxxxxxxxxxxxoxooxxxouuuxxxupouuxxuuuouuxxoxuxxxxxxxxxxououoooxxxxuuxxxxxuuxoxxxxoxxxxxxuxxxxxxuxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxoxoxxxxoxxxxxxxxxxxxxxoxxxoxxoxxoxoxx",
-"xoxxxxxxxoxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxoxoxxxxxxxxxxxxxxxxxouxxoopoouxxxxouxxxxxxpxxxxxxxxxxxotuupuxxupuuuxxopuuxxoppppupxxxxoxxxxxupuxxxxxpxpxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxtuupxxotuuoxxututupuxoxuxxxxxxxoxxoututupoxotuutoxxpuutuxxupuupxxxxuxxxxxxooxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxoxooxxoxxxxxxxxx",
-"xxxxxxoxxxxxxxoxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxoxxxoxxxxxxxuxoxxxxxoxoxxxxpxxxxxxuoxxxoxxxxxxuuuuutxxoxxxoxxxuxxxxxuoxuxuxxxxuxxxxxxxxuxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxooxxxxxxuxxuxoxuxxxxxxtxuxxuxxxoxxxxopttptxxtxuxxuxuxxxxuxuoxxxuxxpuuupxxxxoxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxoxxxxxoxxxoxxxxxxxxoxxoxxxoxoxxxox",
-"xxxoxxxoxxxxxxxoxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxoxxxxxxxxoxxxxxxuxxxoxoxoxxxxxxuoxxoxxopxxxxoxoxxopuuuuuxxoxxxooxxuxxxxxuuxoxuxxxxoxxxxuxxxuxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxuxouxxxuxxxxxxpxuxxuxoxuxxxxxxxxxxxxpxuxouxuxoxxuxuxxxxoxopuuuuoxxxuxxxxxxxuxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxoxxxxxxoxxoxxxxxxxxxoxoxxxxxxoxxx",
-"xoxxxxxxxoxxxxxxoxxxoxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxoxxoxoxxxxxoxxxxxxxxxxoooxxxxxxxoxxxxxuxxxoxxuxxxxxpuoxxopoxxxxxuxxxuxoxuxxxxxuoxuxoxxxxuxxoxoppuoxxxxxxxxxxoxxxxxxxxxxxxxxxupoxxoxxxoxoxxuxxooxxuxoxxxxtxuxouxxxuxxxxxxxxoxxxpxuxxuoouxxpoxouxxupxxpoxxxxxxxuxxxxxxuxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxoxxxoxxxxxoxxxxxxxxxxxxxxxxxxxoxxoxxxxx",
-"xxoxxoxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxooxxxoxoxxoxxxxxxpxxxoxxxxxoxxxxuoxxxxxouxxxxpuxxxxxppuoxopuxupuxxoppuoopuxpxouxpppppxxxxuxxxxxxxxxxxxxxxxxxxxxxxxxxxxopxxxxoxxxxoxppooppxoouppoxppxuoxpxuppppoxxxxxxxxppxuoxpxxoppooxxoppouuxxuppoxxxxuxxxxxxuxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxoxooxxxoxxoxxoxxxxxxxxxoxxxxxxoxxox",
-"xxxoxxxxxxoxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxoxxxxxxxoxxxxxooxxxxxxxxxxoxxxoxxxxxxoxxxxxxxxxxxxxxxxxxxoxxoxoxxxxxxxxxxxxxxxxxxxoxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxoxxoxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxoxxoxxxxxxxxoxoxoxxxxxxpxxxxxxuoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxoxxoxxxxxxxxxxxxxxxxxxoxxxoxxx",
-"xoxxxoxxoxxxoxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxoxoxoxxoxxoxxxxxxxxxxxxxxxxxxxxxxxoxxxxxoxxoxoxxxxxxoxxxxxxxxxxxxxxxxxxoxxxxxxxxoxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxoxxxoxoxxoxxoxxxxxxxxxxoxxxxxxxxxxxoxxxxxxoxxxxxxxxxxxxxxxxxxxxxxoxxoxxxxxxxxxoxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxoxoxxxxxxxxoxxxoxxoxxxxxxxoxxxxxxxox",
-"xxxoxxxxxxxxxxoxxxxxoxoxxxxxxxoxoxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxoxxxxxoxxxoxxxxxxxoxxoxxxxoxxxoxoxxxxxxxxxxxxoxxxoxoxxxxxxoxxxxoxxxxxxxxoxxxoxoxxxxoxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxoxxxxxxxxxxoxxxxxxxxxxxxxxxxoxoxxxoxxxxxxxxxxxoxxoxoxxxxxxxoxxxxxxxxxxxxxxxxxoxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxoxoxoxxxoxxxxxxxxxoxxxxxxxxxoxxx",
-"xxxxxoxxxxoxxxxxoxxxxxxoxxxxxxxxxxoxoxxxxxxxxxxxxoxooxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxoxxxxxoxoxxxoxxxxxxoxxxxxxxxxxxxxxxxxoxxxxxxxoxxxxxoxxxxoxxoxxxxoxxxoxxxxxxxxxxxxxoxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxoxxxxoxxoxxoxxxxxxxoxoxxxxxxxxxxxxxxxxoxoxxxoxxxxxxxxxxoxoxxxxxxoxxoxxxxxxxxxxxxxooxoxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxxxxxxoxxxxxoxxxxxxxxxxxxxoxxxxxx",
-"oxxoxxoxoxxxoxoxxxxxxxxxxxxxxxxoxxxxxxxxxxxxxxxxxxxxxxoxoxxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxoxxxxoxxxxxxxoxxxxoxxxxxoxxxxxxxxxxxoxxxxoxxoxoxxxoxxxxxoxxxxxxxxoxxxxxxxxxxxxxxxxxxoxxoxxxxxxoxoxxxxxxoxxxxxxxxxxxxxxxxxxxxxxxxoxxxxoxxxoxxxxxxxxoxxxxxxxxxxxxoxxxxoxxoxxxxoxoxxoxxoxxxxxxxxoxxxoxxxxxxxxxxxxxxxxoxxxxxxoxxoxxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxxoxxxxoxxxxxxxxoxxxxxxxxoxoxxxxxxxoxoxx",
-"xxxxoxxxxxoxxxxoxxoxxxxxxxxxxxxxxxxxxxxxxxxxxxxoxoxoxxoxxxoxxxoxxxxxxoxxxxoxxxxxxxxxxxxxxxxxxxxxoxxxxoxoxxxxoxxxxoxxoxxoxxxxxxxxxxxoxxxxoxxxxxoxxxoxxxxxxxxxxoxxxxoxxxxxxxxxxoxoxxxoxxoxxoxxxxxxxxxxxxoxxxoxxxxxxxxxxxxxxoxxoxxxxoxxxxxxxoxoxxoxxxxxoxoxoxxxxxxxxxxxxxoxxxxxxoxxoxxxxoxxxxxxxoxxxxoxxxxoxxoxxoxxxoxoxoxxxxxxxxxxxxxxxoxxxxoxxxxxxxxxxxxxxxxxxxxxoxxxxoxoxxoxxoxxxoxxxxxxoxxxxxxxxxox",
-"xoxxxxoxoxxxxxxxxxxoxxxoxxoxoxxxoxoxxxxxxxxxxoxxxxxxoxxxoxxxoxxxxxoxxxoxoxxxoxxxxxxxxxoxxxxxxoxxxxoxxxxxxxxxxxxoxxxxxxxxxoxxxxxoxxxxoxoxxxxoxxxoxxxxxxxoxxoxxxxoxxxxxoxxoxoxxxxxxoxxoxxoxxxxoxoxoxxxxxxxoxxxxoxxxxxxxxxxxxxxxxoxxxxoxxoxxxxxoxxxoxxxxoxxxoxxxxxxxxxoxxxoxoxxxxxxxxoxxxoxxxxxxxxoxxxxoxxxxxxxxxxxxxxxxxoxoxxoxoxoxxxxxxoxoxxxoxxxxxxxxxxxoxxxxoxxxxxoxxxxxxxoxxxoxxxxoxoxxxxxxxxxxxxx",
-"xxoxxxxxoxxxoxoxoxxxxoxxxxxxxoxxxxxxoxxxxxoxxxxoxoxxxoxxxxxxxoxoxxxxoxxxxxxxxoxxxxxxxxxxoxxxxxxoxxxoxxoxxoxoxoxxxoxxoxoxxxoxoxxxxxxxxxxoxoxxxxxxxxxxxxxxxxxxxxxxuoxxxxxxxxxxoxxoxxxxxoxxxxouoxxxxoxooxxxxoxxxxoxxxxxxxoxoxxxxxxoxxxxoxxxoxxxxxxxxoxxxxoxxxxxxxoxxoxxxoxxxxxoxxoxxxxxxxxxoxxoxxxxoxxxxxoxxxoxoxxoxoxoxxxxxoxxxxxxoxoxoxxxxxxxxoxxxxxxxxoxxxxxxxoxxoxxxoxxoxxxxoxxxoxxxxxoxoxxxxxxoxxx",
-"xxxxxxxxxxoxxxxxxxxxxxxxoxxoxxxxoxoxxoxoxxxxxoxxxxxoxxxoxxoxxxxxxoxxxxoxoxxoxxxxxoxxxoxxxxxxoxxxoxxxoxxxxxxxxxxxxxxxxoxxoxxxxxxxoxxxxxxxxxxoxxxoxxxoxxxoxoxoxoxxxoxoxoxoxxoxxxxxxoxoxxoxoxxxxoxoxxxoxoxoxxxoxxxxoxoxxxxxoxxoxxxoooxxxxxxxxxxoxxoxxxxoxxxoxoxoxxxxxxxxxxxxoxxxxxxxxoxxxxxxoxxxoxxxoxxoxxoxxxxxoxxxxxxoxoxxxxxoxoxxxxxxxoxoxoxxxoxxxoxxxxxxxoxxxxoxxxoxxxxxxxxxxxxxxxxxoxxxxxoxoxxxoxx",
-"xoxxoxoxxxxoxxxxxxxoxxoxxxxxxoxxxxxoxxxxoxoxxxoxoxxxoxxxoxxxoxoxxoxxxxxxxoxxxoxxxxxoxxxoxxxxxxxxxxoxxxxoxxoooxxooxxoxxooooooxoxxxooxoxxxxxxxooxoxoxxxoxoxxxxxxooxoxxxooxoxxxoxoxxxxoooxxxoxxoxxxooxoxxxxxooooxxxooxoxoxxooxxxoxxoxxoxoxoxxoxxxxxxxxxxxoxxxxxxoxoxxxxxoxxxxoxoxxxxxxoxxoxxxxoxxxoxxoxxxxxoxxoxxoxoxoxxxxoxxoxxxxoxoxxxxxxxxxoxxxxxxxxoxxxoxxxoxxxxoxxxoxoxxoxoxxoxxoxxxoxoxxxxxoxxxxx",
-"xxoxxxxxoxxxxoxxoxxxxxxxoxoxxxoxxoxxoxoxxxxoxxxxxxoxxoxxxxoxxxxxxxoxoxxoxxxoxxoxxxxxxxxxoxxoxoxxoxxxoxxxxxoxooxxxoxooxxxooxoxxxooxooxxoxoxoxxooooooxxxoxooxoxooooxoxooxoxoxoxxxxxoxxoxoxxxoxxoxxxxooxxoxoxoxooxooxooxxxxxoxxxxxxoxxxxxxxoxxxxoxxoxoxoxxxxoxoxxxxxxoxxxoxoxxxxxoxxxxxxxxxoxxxxoxxxxxxoxoxxoxxxxxxxxxoxoxxoxxxxoxxxxoxxoxxoxxxoxoxxxxxxoxxxxxxxxoxxxxoxxxxxxxxxoxxxxxxoxxxxxoxoxxxxoxx",
-"xxxxoxoxxxoxxxxxxoxxoxxxxxxoxxxxxxxxxxxoxoxxoxxoxxxoxxoxoxxoxxoxoxxxxoxxoxxxoxxoxxxxxoxxxxxxxxoxxxxxxoxoxxooxoxoxoxxoxoxxxxxoxxoxxxoxxooooooxxxxxxoxooxxoxxxoxxxxoxoxooooxxoooooxxoxoooxoxxxoxxoxxxoxxxxxoxoxxxxoxxxxoxxxoxxoxxxoxoxxoxxxxoxxxoxxxxxxoxoxxxxxoxxoxxoxxxxxxoxxxxoxoxxoxxxxoxxxxxoxoxxxxoxxxoxxoxxoxxxxxoxxoxxxxoxoxxoxxoxxoxxxxxoxoxxxxxoxxoxxxxoxxxxoxxoxoxxxxxoxoxxoxoxoxxxxoxoxxox"
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkknkkkkkkknkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkknikkkknninkkkkkkkkkkknninnnkkkkkkkkkinkkikkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkknknkkkkkkkkkknkkkkkkkknkkkkkknkkkkknkknkkkkkkkkkkkxkkkkkkknkkkkkkknkkkknknkkkkkkknkkkkknknnkkkkkkkkknkkknkkkkknkkkkkkkkkkkkknkkkkkkkkkkkkknkkkkkkkknkkkkkknkkkkknkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkknnkknnnnikkkkkkkkkknnnnkkknnnnnkkkinnikkkkkinnkkkkkkkkkkikkkkkkknkkkkkkknnkkkkkkkkkkkinnnnkkknnnkkkkkkkkkknnninnkknnnnnkkknnninkkinnnnkkkkkkkkkkinnnkkknnnnnkknnnnnkkknkxnkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkknkkknkkniiiinkknkkknkknkkknkknkkkknkknxkkkkkkkkkkkkkkkkkkkkknkkkkkkiinnkkkknkkkknnnnnxkkkkxkkkkniiiinknnknknkknkkkkkknkkkknknnnnnikkiiiiikkknkknkknkkkknkknkkkknkknikkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkknkkkkkkkkkknkkknkknkkkknknkkkknkknnikkkkkkkkkkkkkkkkkkkknkknkkikkknkkkknkkkknnnknnkkkxkikkkkkkkkkknnknknkknkkkknknkkkknkinnnnnkkkkkkkkkknkknkknkkkknkknkkkknkkinnkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkknnkknkkkxkkkkkkkkkknkkknkkinkkikknnkknnkknkkikkkkkkkkkkkkkkkkkkknkknkkikknnkkkknkkkkkxkkkkkkikkkikkkkkkkkknnknknkknnknxkknnkkinkkxkkkkkkkkkkkkkknkknkkkikknikkinkkikkknknnkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkknkknkkninnikkkkkkkknxkkixkkkixxnkkknxxnkkiikkxxkkkkkkkkkkkkkkkknxxxxxkknxxkxnkkixxnkkkkxxikknxiknxnkkkkkkknxikxknnkkixikkkknxikxnkkixikkkkkkkkkkixkkxxkkkixnkkkkixxkkkxnknxikkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkknkkknkkkkkkkkknknkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkknkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkknkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkknkkkkkkkkkkknkkkkkknkkkkkkkkkkkknkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkknkkkkkkkkknkknkkkkkkkkkkkkknkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkknkkkkkkkkkkknkknkkkkkkkkkkkkknkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkknknkkkkkkkkkkkknkkkkkkkkkknkknkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkknkkkkkkkkkknkkkkkkkkkknkknkkkkkkkkkkknkkkkkkkkkkkkkkknkkkkkkkkknkkkknkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkknkkkkkkkkkkkkkknkkkkkkkkkkkknkkkkkkkkkkkkknkkkkkkkkkkkkkknkkkkkkkkknkkkknkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkknknkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkknknknkkkkknkknkkkkkkkkkkkkkknkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkknknkkkkkknkknkkkkkkkkkkkkkknknknkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkknkkkkknkknkkkkkkkknkkkkkkkkkkkkkkkkknkkkknkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkknknkkknkkkkkkknknknkkkkknkknkknkknkknkkkkkkkknkkkkkkkkkkkkkkkkknkkkkkkkknknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkknkkkkknkkknkknkkkkkkkknknknkkkkkkkknkkkkknkknkkkkkkkknkkkkkkkkkkkkkkkkknkkkkkkkknknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkknkknknknkknkkkkkkkkkkkkkkkkkkkkkknkkkknkkkknkknuunnkknkkkknkkknkkkkntkkkkkkkkkkiikkkkkkknkkkkkknkkkknnkkkknnkkknkkkkkkkkkkkkkkkknkknkknkkknknkkkknkkkkkkkkkkkkkkknkknkknkkkkkkknkknkknknkknknkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkknkkkkkkkkkkkknkkkkkkkkkkkkkkkkknkknknkkkknkkkkkknkkkkkkkkkkkkkkknkknkknkkkkkkknkknkknknkknknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkknkknkkkknkkkknkkkkkkkkkkkknkkkkkkkkkknktnkkkkiknkkkknkkkkkkkkkkkkikkkkkkkkkkkinkkknkkkkknkkkknknkkukkkktkknkknkkkkkkknknkknkkkknknknknkkkkkkkkkkkkkkkkkkkknkkkkkkkkkknkknkkkknkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkknkknkkkknkkknknkkknknknkkkkkknknknkknkkkknkknknkknkkkkkkkkkkkkkkkkknkkkkkkkkkknkknkkkknkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkknkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkknknkkkkkknknkkkkkkkknkknkkknkkkkkknkkkkkkkkktkkkknikkknnkixnknininnnkkxkninkkkkiikikknniikkkkknkkkkkkkxnknkkiikkknknkkkkkkknkkkknkknkkkkkknknknkkkkknkknkkknkkkkkknkkkkkkkkkkkkkkkknkknkknkkknkkknkkkkkkkkkkkkkkkkkkkkkknkkkkknkknkkkknkkkkknkkkkknkkkkkkkknkkknkknknkkkkknkknkkkkkknkknkkknkkkkkknkkkkkkkkkkkkkkkknkknkknkkknkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkknkknnknkkknnkkkkkkknkkkkkkkkknkkknkkkkkkknnknkkkxnkkkknixtkkxuxuxxikitxiukkktiiuxkknixxikkkkknkkknkktkkkkkktkkkkkkkkkkknkkknknkkkknknknkkknkkkkkkkknkkkkkkkkknkkknkkkkkkkkkknknknkkknkkknkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkknkknkkkkkknkkkkknkknkknknnkkknkkkkkkkknkkkkkkkkknkkknkkkkkkkkkknknknkkknkkknkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkknkkkkkkkkkkkknkkkkkkkkknknkknkkknkkknknkknknkkkxkkkkkkxknknkiuuukknukxkkxkxnkkktkikkkkxkkktutikknkkknknkkkxknknkkxnknkknknkkkkknkkkknknkkkkknkkkkkkkkkknknkknkkknkkknknkknknkkkkkkkkkkknnkkknkkknkkknkkknkkkkkkkkkkkkkkkkkkkkkkknkknkknkkknknknknkkkkkkknkkkkkknnkkkkkkkknkkknkkkkkkkkknknkknkkknkkknknkknknkkkkkkkkkkknnkkknkkknkkknkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknkkkkkkkknkkkkkkkkknknkkkkkxkkkknkxknkkntnktnkkwkxkkxkxkkkkxkxkkkkxkkxnknxkkkkkkkkknkkxnkkkkkxkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknkkkkkkkkknkkkkkkkknkkkkkknkkkkknkkknknkkknkkknkkkkkkknkkkkkkkkkkkkkkkknkkkkkkkkkkknkkknkkkkknkknkkkknkkkkkkkkkknkkkkkkkkkkkkknknkkkkkkkkknkkkkkkkknkkkkkknkkkkknkkknknkkknkkknkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkknnknnkxknkknxkknkxkkkwknkwkxkkxkxunkxnkntkkttkktkkixkkkknkkkknkktkknknnxkknkknknknkkkkkknkkkknknkkkkkkkkkknkkkkkkkkkkkkkkkkkkkknknkknkknkkknkkkkkkkkkknkkkknknkkkknkkkkkkkkkkkkkkkkkkkknkknkknknkkknkkkkkkkkknkknkkkkkkknkkknkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkknknkknkknkkknkkkkkkkkkknkkkknknkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknkkkkunkkxwwwwikkuwunwkwwktikwnwnwwnkkknwwittkiwwnwnnkkkknkkkkkntkkkktnnkknkkkknknknnnnnnnnnnnnnkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknnkkkkkknkknnkknkkknkknknkkkknkkkkkkkkkkknknkkkkkknkkkkkkkkkkkknkknknnnknknkkknknknknnkkknknknknkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknnkkkkkknkknnkknkkknkknknkkkknkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkrrrrrrrrrbrrrrrrbrrrrrrrrrrrrrikinnkkknirrrrrrrrbrbrbrrbrrriknkkkkkkrrrrrrrrrrrrrrbrrrbrbrrrrbrrrrrrrrrrrrrrrrrrssssssgsggbkkkkkkknkkkkkkkkkknknkknkkkkkknkkkkkkknkkkkknknkkkkkkkkknknkkknknknkkkkkkkkknkkknkknknknknknkkknknkkkknknkknkknknkknkknknkkkkkkkkkkkkkknkkkkkkkkkknknkknkkkkkknkkkkkkknkkkkknknkkkkkkkkknknkkknknknkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkrhhhqhhhhhhhhhhhhhhhhhhhhhhhhhhmkkknkkkivhhhhhhhhhhhhhhhhhhhmknknkkkrhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhtnknkkkknnkkkkkkkkkkkkknkkkkkkknkkknkkknknkkkkknknkkkkkkknnnkknkkkknknkkkknkknkkkkkkkkkkkkkknkkknknnkknknkkknkknknkkkkkkkkkkknknnkknkkkknnkkkkkkkkkkkkknkkkkkkknkkknkkknknkkkkknknkkkkkkknnnkkknkkknknkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkknknknkkihhhhhhhhhhhhhhhhhhhhhhhhhhhhhhodknkkkknvhhhhhhhhhhhhhhhhhhhockkkkkkihhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhoenkkknnkkkkknkknknkknkknknnknkkkkkkkkkknkknkknkkkkknknkkkkkknkknknkkkkkkkkkkkkknnkknknknnkknknknkkkknkknknkkkkknkknnnkknnkkknkknknkkknnkkkkknkknkkknknkknnnkkkkkkkkkkkknkknkknkkkkknknkkkkkknkkkknkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkknkkknkkmohhhhhhhhhhhhhhhhhhhhhhhhhoooldkknknkkbhohhhhhhhhhhhhhhhholdnknnkkkmohhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhlcnknknkkkkknkkkkkkknknknknkkkkkkknkknnkkkknkkkknnkkkkkkknknkknkkkkknknnkkkkknkkknnkkkkkknknkknknknknknknknknknkknkkknkkkknnkknknknknknkkkkknkkkkknknkknkkknknkkkknkknnkkkknkkkknnkkkkkkknknknnknkkknknnkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkknkknkkkdpllhhhhhhhhhhhhhhhhhhholeepddwnkknknkkwdddqhhhhhhhhhhooeepwknkkknkkddjeoqhhhhhhhhhhhhhhhhhhleeeeeeelloohhhhhhhhhhhhhhhhl`nnnnknknknknnknknkknkkkkkknkknkkkkkkknknkkkkkkknnnknknkkknnkkknnnkkkkkkknkkkknkkknkkkkkkkknknkkknkkkknkkknkkknknkknnknkkkkkkkknknknkkknknknknknkkkknkkkkkkkkknkkkkkkknknkkkkkkknnnknknkkknkkkknknkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkknkx`fhhhhhhhhhhhhhhhhledtnnknnnnnnnnnkkkknshhhhhhhhhlej`nnnnniknknkkkkknghhhhhhhhhhhhhhhhoel`xnninitwudplohhhhhhhhhhhhheunnnnnnnknknkknkknnnkkknknkkkkkkkkkknkknkknnnkkkkkkkkkkkkkkkknkkkknnknkkkkkkkkkkkkknkkknkkkkkknnkkkknkkknknnnkkkkkkkkknkkknknkkkkkkknkkknknknknknnnnknknnknkkkkkkkkknkknkknnnkkkkkkkkkkkkknknkkknknnknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknnmhhhhhhhhhhhhhhhlcxxiixixxxxiinnnkkkighhhhhhhheeaxxxxxxxiiinnknkknnivhhhhhhhhhhhhhhhejxxixxxxxxxxxii`dohhhhhhhhhhoetxtxxinnnnknknknknknnnknkknknkkkknkkkknknnkkkkkkkknkkknkknknknknknkknknknnkkkkknkkkknkkknnknknkkknkkkknknkkknknknknkkkknkkkkkknknkkkkkkkkknknknkknknnknkkknknkkknkkkkknknnkkkkkkkknkkknkknkknknkkkkknkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkknkkkkknkkkkkkkkkkkkknirfhhhhhhhhhhhhhhecuuwwuuuuuuutxnnnkkrvhhhhhhoeewuwwwuuuuutxxnnknkknrvhhhhhhhhhhhhhhoewwuwuuuwuuwuwuuuuwdqhhhhhhhhoew`wwwuxnnnkknkkknknknknknkkkkknnkknkkkknknnknnknkkkkknkkkkkkkknknkkkkkkkkknknkkkknkkkkkkknkknkknkkknknkkknnknnnkknkkkknknkkknkkkkknkkkkknkkkknkkknkknnknnkkkkknkknknkkknknnknnknkkkkknkkkkkkkkknnnkkknkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkknknitshhhhhhhhhhhhhhlcccccaaaa``wuxinnkrbhhhhhhoejdccaacacaaa`utxnnkknnrvhhhhhhhhhhhhhhllccaccaaaaaaaaaaaaaaaqhhhhhhhljcdcca`txnkkkkkkknknkkkkkknnnknkknnnknkkkkkkkknkkknnkkknkknknkkkkkknkknnkkkknkknkkkkkkkkkkknkknknnknkknknkknkknknknknkknknkkkknknkkkkkkkkkkkkkkknknnkkkkkknnnknkknnnkkkkkkkkkknkkknnkkknkknknknkkkkkkkknkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkniughhhhhhhhhhhhhhljjpjpppdcaa`utxnnirfhhhhhoeejjpjpjpppddcaaccxnkkinrhhhhhhhhhhhhhhhejjpjppppjpccaccccccddvqhhhhhheejjjjpawxinkkkknkkknknnnnnkknknknkknknnkknkknknknnkknkkkkknkknknkkkkkkuukknkkkkknkkkkkkkknkkknnkkkknkkknknknknkknknknkkkkknkkkkkknknnkkkkknkkkknkkkknknnnkknknknnknknnnkknkknknknnkknkkkkknkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknnituvhhhhhhhhhhhhhoeeejejpdca`wuxinnrmhhhhhoelpjejejejjjdda`ctnkkkkxnrhhhhhhhhhhhhhhoeeeeejejpdpcaaa`aaaccddmhhhhhheeeeejpc`cdannknknkknknxa`cackknknnnnkccnkcaknkkknknkkkknkkknknkkkkkkkkktkkkkkkkkknkkkkkkkkkknkkkknkknkkkkkknknknknkkkknknknkknkkkkkkkkkkkkkknknknknknknknkkkknknknnknknnkkkknkkknknkkkkkkkknknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkniitshhhhhhhhhhhhhheeeejjpc`wutxinnrshhhhhoejcdpeeeeeejpc`aaautnnkttishhhhhhhhhhhhhhleeeeeeljpccwaa`uwwacaacsqhhhhoeeeeeejcwxunknkkkittkkktkntktnknxtinknndknwnkkkknknktitniikkkntxkkkkkxxkxkkkitxkkkknknkknxxxkxnnnkitxknntkttnknknknknnkkknkknkkknknkkkkkkknknkkkkknkkknknknnkknknnknknnknknnkkknkknnkkkknkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknknnirhhhhhhhhhhhhhheeeeepc`utxxinnighhhhhoepcapjeeeeejjp`wwwatxkknt`rmhhhhhhhhhhhhhhleeeeeejpc`ata`uxxca`ccwwmhhhhleeeeejpawxunkknkktttwnnkkktkkkn`uuu`nknn`cknnnkkkkkkt`xaxuikn`xx`nkk`ttaukk`uxw`nkkkkkkknwuu`xwknntxuiki``ut`xkknkknknnnknkkkkknkkkkkkkknkkkknnkknkknnkkkkkknknnknnnnknknnknnkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkknknnknivhhhhhhhhhhhhhleeejpauxinnnnrbqhhhhoedwiwapjeeejjdjtxinunnnkkktrfhhhhhhhhhhhhhheeeeeeeejwuwctnnni`uuwcutshhhheeeeeejpauxuknnknkua`uknnkktnknn`ttuaxknn`wknkxaaacakkckxkkxkxkkkktktnkkkwki`ttxaxnwaaa`tkttntktkkn`autkktnknkwkknknkkkkkkknknkknkkkkkkkknnnknkknkknknknnkknkknkknknknnnnknknnkkknnkkknkkkkkkkkkkkkkknkkkkkknkkknkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkknkkkkkkkkkkknknknkknknknshhhhhhhhhhhhhoeeejd`uinnkkrrqhhhhhednuxucpejejpda`xinntnkknnkxrhhhhhhhhhhhhhhoeeeeeejpaux`x`nnnx`ttuuiighhhheleeeejp`tiunkntktxnnwkknkntknkx`ttttnnkwxttkkkkkkkkknaktkktktkkkktktknnktkx`ttttnkknkkkkkxxkuntnkunkntkkunknkwnkkknkknknnknknknknkknnknkkknknnnknknnkknknknknknnnknkkkknkkkkkknkkkkknkkkkkkkkkkkkkkkkknkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkknknkkkkkknknknknkbhhhhhhhhhhhhhheeejd`tinknrbqhhhhoejnnu`wdjejjjauxxnnnkuknkknnbshhhhhhhhhhhhhhleeeeeejc`titni`knkcxkniknrhhhoepjeeejd`titnknukwkkn`nknkktkknncxkknkktxnkcnknkkknkkkaktkktkitkkuxkn`knw`nkaxnnnnkkkkkkkktxntntnnukktxkkx`nkuinnnknknknkkkknnkkkknnkkknnknknkknkkkkkknknkkkkknknkkkkkkkknnknkkkkkkkkkkkkkkkkkkkknkknkkknnkknkknkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkknknknnknknkkknnnfhhhhhhhhhhhhhleejd`tnkkibqhhhhheeinnxajjjepdadd`xknwcccwkntarmhhhhhhhhhhhhhheeeeeeepcwx`unkcanknwcwxknrhhhoecpeeepcwwccccaxkicctuwkntcccnnknwa`xkkaakkackkknkknnaakuikakkiacxknknacxwwnnua`xnknkkkkkiawkanxwkuccicxktn`ciknkknknknknknkkkkknkknnnknnknnnnnkknnnkknknknknnnknnknknkkkkkkkkknknknnkkkkkkkkkkkkkkkkknknknkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkknkkknnknkknmhhhhhhhhhhhhhoeejpauxnirfhhhhoeltxnit`cpjpd`utnnkknnnknknkknrqhhhhhhhhhhhhhoeeeeeejpauxknkknnknknknnkkrhhhld`djjjpcwxnnknknnknknknkknkkknkknnnnnkknknkkkknkknkkknkkkkkkkkkkkkkkkkknnnkkknkknkkkkkkkkkkkkkknnnkkkknnktkkknkknnnknnkknkknkknkknkkknkknnkkkknnnnknnnknknkknknknnnknkkkknkkkknkkkkkknkkkkkkkkkkkknkkkkknkknknkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkknkkkkkkknknknnknkknknknbhhhhhhhhhhhhhheeepcuxirvhhhhheliknxtwcpppcawxinknknknnknknknbhhhhhhhhhhhhhhoeeeeeejp`unkkkkkknknknknknghhhe`wcpjjpattnnnnnkknknknknnknkknnkknkkknkkkkkkkknknkknkkknkkkkkkkinknknkknknnnknkknknkkkkkkkkkkknkknknnkknxpctkkkkkkknkknnknnkknnkknknknnnknnnnnkkkkknknkknknkknnkknknknnkkkkkkknknnknkknkkkkkkkknnknkknknknknkkknkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkknkkkknnkkkkkkkknknknnkkkkkiqhhhhhhhhhhhhhleejcwrrvhhhhheennnitwadppc`utxnnnkkknknnknnkrshhhhhhhhhhhhhhleeeeeejdwuxinkknnnnknnknnnnmohetuapjjd`xxnnknnknkknknknknnnkknknknknknnkknknnkknnknknkkkkknkkkknnnknkknnknnknnknkknkkknnknkkkkknnnknknknknnnkkkkkkknnnknnnnnknnnkknkknkknnnnnnnnnkknknnnknnkknknkknkknnkkknnnknknkknkkkkkkkkkkkknknkkkknknkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkknkkkkkkkkknkknkkkknknkkknnnknmhhhhhhhhhhhhhoeejdtrvhhhhhelnnnitwadppd`uxnnnknnnnknnnknkkrvhhhhhhhhhhhhhheeeeeeepcwxinnknrgvbrknnnnknncjlit`dppcwxnnnnknknnnknkknkknknknknnnnkkkknnnnkknnkkknkkknkkknkkkknnnnnnknknnnnknkkkkknknkkkkkkkkkkkknnkknnnnnnnknkkkkkknnnknnkkknknnknnkkkknknkkkknnknkkkknkknnnnninnkkkkknkkkknknknkknkknkknkkkknnnnknkkkknnkknnnkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknkkkkknghhhhhhhhhhhhhheeesrvhhhhoeeinnxtwadppcawtikkkkkkknkknnknknrhhhhhhhhhhhhhhoeeeeeejp`uxnnnnnrqhhwxknnknnkkkkixwapdauinnknknkkknknnniirnikkknkknnniirrggsgikknnnknnkknkkknirrrgsggnnknkknknkkkkkknkkkknkkkkkkknknknirrbsssbnnnnkkkknnnnniiiikkkkkkkkkkknnknnnkknknnnnnnirrrsssggrnnnkkknkkknknnknknnkknkknrrrbsgsgrnnnkkkknrsgrkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknnkkknnknnhhhhhhhhhhhhhhlewrvhhhhhelinnitwadppdawtinkkkknkkknkknknknghhhhhhhhhhhhhhoeeeeeejd`tiinknrshhhetkkkkkkkkknnxwcdd`uiknknnnnniiirrrssvqsikkkkknkrrgvhhhhhhminknknknknnknrbmqhhhhhhmiknknknknnnknkkknnknkkkkkkkkirrsvhhhhhhqgkknnrrrgssgssvmsnknkkknkkkknnnkkkknknknirbsmqhhhhhhhfsrkkkknkkknknnnkknknnnrbmfhhhhhhhfsrnnknrghhhtkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknkkkkknnfhhhhhhhhhhhhhoprvhhhhheennnxtwaddpdawxiinkkkkkknknknkknnrmhhhhhhhhhhhhhheeeeeeejcwxinnkirqhhoekkkkkkkkkkknxuaccwxrrrrrrssssvvfhhhhhhlankkkkirgqhhhhhhhhhqxnnknknkknrbmhhhhhhhhhhhgknkknnkkknknnkkkknkkkkkknrrsqhhhhhhhhhhfnkrshhhhhhhhhhdakknkkknkkkknnnknkkknrrgvhhhhhhhhhhhhhhmnknknnknknknnnkknrbmhhhhhhhhhhhhqvsbrgqhhoekkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknnknknghhhhhhhhhhhhhhrshhhhhelinnitwacppdawxinnnnkkkkkkkkkkknkkrfhhhhhhhhhhhhhheeeeeejpcuxinnirmhhhopkkkkkkkkkkknit`aaugvfhhhhhqhhhhhhhhhhhetnnknrrvhhhhhhhhhhhhhinnnknnnrsqhhhhhhhhhhhhhwknkknknknkknknknkknkkkirsqhhhhhhhhhhhhhdnrfhhhhhhhhhhlakkkknkkknkkkknnnnnirgfhhhhhhhhhhhhhhhhhfnnkkknknnknknknrsqhhhhhhhhhhhhhhhhhhhhhhodkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknkkrhhhhhhhhhhhhhhshhhhheeinnituadppdawtinkknwctkkkkkkxkkkknrhhhhhhhhhhhhhhoeeeeeejp`uinnnrghhhhlankni`dxkknknixw`wxshhhhhhhhhhhhhhhhhhljnnnnibqhhhhhhhhhhhhhqonntnnirshhhhhhhhhhhhhhhhwcxnknknknknkkkknkknkrbvhhhhhhhhhhhhhhqhurhhhhhhhhhhhexkknxcwkkkkkkkkkknrbmhhhhhhholeedqhhhhhhhqnnnnknknnnnnnrshhhhhhhholeeelhhhhhhhhhhlckkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknnknnvhhhhhhhhhhhhhhhhhhlexnnixwacdpda`uxnnkkkukknkkkkiwknkkrghhhhhhhhhhhhhhleeeeeejdwxinnrrqhhhhexkniiiiwnkkknnxtutxghhhhhhhhhhhhhhhhhheanknrrqhhhhhhhhhhhhhhho`i`iirvhhhhhhhhhhhhhhhhhlpnknnwdpaknnknkknknrbqhhhhhhhhhoeeehhhhvshhhhhhhhhhoennknnkukkkkkkkknnrsqhhhhhhhlepuxnshhhhhhhhonknnknnknknrgqhhhhhhhledunkiwfhhhhhhhhlwnknnknkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknknnmhhhhhhhhhhhhhhhhhlecxiitu`ddpdawtxnnkkkkunkknkkk`kkkkkrvhhhhhhhhhhhhhheeeeeeejpwtnxrbqhhhhoeuinxttt`nnnkknnxxixrcllhhhhhhhhhhhhhhhetiurbqhhhhhhhhhhhhhhhhhjtxwrshhhhhhhhhhhhhhhhhhoaxinnnkuknknknxtxnrshhhhhhhhhheecxxumhhvvhhhhhhhhhhljtxiiinwknknnkttirshhhhhhhhledtnirmhhhhhhhhhpxnnitiutnnrqhhhhhhhoewnniituxvhhhhhhheuniixxinknknkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknkknkkkkkkkkknkkrhhhhhhhhhhhhhhhhlepwtttu`cpddawuxiinnkkktknkknnkwkkkk`rqhhhhhhhhhhhhhheeeeeeejduxrrsqhhhhhlpudtuw`wainnknknnninxwccashhhhhhhhhhhhoextrbqhhhhhhhhhhhhhhhhhhewurshhhhhhhhhhhhhhhhhhhodttxnnnunknknnuturshhhhhhhhhheedwxtuwfhqhhhhhhhhhhhedacxtttwinnkndubrvhhhhhhhhledw`crbqhhhhhhhhhld`xxaauuwrshhhhhhhhepuiitu`c``qhhhhhhexix`wuuinnininnkkknkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknnkknkkkkkkniqhhhhhhhhhhhhhhlejd`wuwacdpdawtxinnnnknktknnkknkunnnxibhhhhhhhhhhhhhhoeeeepdcwtrrgfhhhhhhhl`iiaw`awainnnkkkknknknwnnrhhhhhhhhhhhhljubbqhhhoelvhhhhhhhhhhhhecrghhhhoeeqhhhhhhhhhhhhojawutxnuknknkna`rghhhhhhhhhoee``ju```shhhhhhhhhhhhoew`awwwuainnnunirvhhhhhhhhoedwwwprmhhhhhhhhhhopjtxwnnntrqhhhhhhhhetwuww`adccshhhhhoeutu``wttnkikkkkkknkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkknkkkkkknkknkknknknkkkkknshhhhhhhhhhhhhoeeedc``adppda`txinnnkkkkntkknnknnunknuishhhhhhhhhhhhhhsrbrrrsssmvhhhhhhhhhhetitaacc``innknknkkknnnukkrhhhhhhhhhhhhedgrfhhhlectbhhhhhhhhhhhoegbqhhheecitmhhhhhhhhhhhoepcautiwnkunkwirshhhhhhhhhhleaaadacpdshhhhhhhhhhhhlecddccawaxnnntirvhhhhhhhhhedc`aa`rhhhhhhhhhhhoep`u`xnntghhhhhhhhhex``ccdppddwfhhhhoea``ccawunniknkkkknknkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkknkkknkknkkghhhhhhhhhhhhhheeejpccddddawuxinnnnnnkkkukkknnknwnnnnrfhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhoeitcccda``inknknknkkkkkunirhhhhhhhhhhhoecrvhhoeecxirhhhhhhhhhhhocrfhhheexnnbshhhhhhhhhhhlejjdauxwnkuknwrshhhhhhhhhhoejw`adpjlashhhhhhhhhhhhejjjejjd`axnnnrrvhhhhhhhhheexp`wa`shhhhhhhhhhhoepdaaxnnbshhhhhhhhhewdcpjjjjdcamhhhhoedddpdcwunkxkkkkkknkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkknkknknnkkkknkrqhhhhhhhhhhhhhleejjppppdcwtxnknkknkkkkkukkknknnwiknkrhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhlpdjacdpjjpd`kknnnkkkkwcddgshhhhhhhhhhhlershhheedpxtbhhhhhhhhhhhorshhheeuinnrmhhhhhhhhhhhleeejdppddddnkrbqhhhhhhhhhhed`pjejjeewshhhhhhhhhhhheeeeejjejppdnnrvhhhhhhhhhoeutwpjlcshhhhhhhhhhhoejjpjdxtgvhhhhhhhhhljjejljjjpp`ghhhhlepjjejcawnxxknkknkkknkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkknknkknnnkkknnmhhhhhhhhhhhhhoeeeejjjdc`txnnnnnnnnnkkkwunkkkknk`nnrghhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhewuwcdpdauxnnnnkknknnkkkkkimhhhhhhhhhhhegbhhheedwtirshhhhhhhhhhhsghhoeeauxxwrfhhhhhhhhhhheeeejpcwxnnnnirqhhhhhhhhhhlewadjjjeljsvhhhhhhhhhhhleeeeeejdatikkrshhhhhhhhhhepu`adpjpshhhhhhhhhhheeejpc`tirvhhhhhhhhhhjjjeejdawttrfhhhljjjejpdwxnkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkknkkknkkkkghhhhhhhhhhhhhheeeejjpcwuxinknkknknkkkkxuinkknknnnkrmhhhhhhhhhhhhhhlelllloohhhhhhhhhhhhoewwcpjjdatxnkkkkknkkknknkkrvhhhhhhhhhhodrfhheejcwtxrmhhhhhhhhhhhrqhhlejawxtubhhhhhhhhhhhheeeeejd`tnkknrvhhhhhhhhhhoeccdjeeejjpbvhhhhhhhhhhhleeeeeejc`tinrbhhhhhhhhhhoeu`cpjjljahhhhhhhhhhoeeeeepawxivhhhhhhhhhhoeeejpawtxiimhhhejjeeepcwxnkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknknkknkkkrqhhhhhhhhhhhhhleeejjc`uxnnnknnnnkkkknnnknnkkkknknnrfhhhhhhhhhhhhhheeeeeeeelllhhhhhhhhhol`cpjjjd`tiknnnkkknknknkknrhhhhhhhhhhhorshhlelpauxxrfhhhhhhhhhhmmhhleepcwtxrmhhhhhhhhhhhoeeeeejd`txnnrshhhhhhhhhhhejcpjjeeejpcrqhhhhhhhhhhheeeeeejjcwxnirqhhhhhhhhhhep`cpjeejpdvhhhhhhhhheeeeejjcwtrvhhhhhhhhhhqeeejd`tinnnshhheadjejpcuxnkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkknkkkknkknkkkkkrvhhhhhhhhhhhhhoeeejpauxinnnnkkkknkkkknnnnknkknnnknrhhhhhhhhhhhhhhoeeeeeeepc`uaqhhhhhhhljdpjljjcwxnnkknknkkkkkknnnshhhhhhhhhhhbghhoeejd`uxtbhhhhhhhhhhhshhoeeepcwutrfhhhhhhhhhhhleeeeejpatxnnbqhhhhhhhhhhoedpjeeeejpcurhhhhhhhhhhhoeeeeeeedauinrmhhhhhhhhhhoecdpjejejd`ufhhhhhhhleeeeeejd`tifhhhhhhhhhhhheejcwtinkkkhhoe`cjjepauinkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkknnknknibqhhhhhhhhhhhhhheeejc`tinkkkkkkkkkkknnknknnnnkkknnishhhhhhhhhhhhhhleeeeeeejdawwuvhhhhhhejpeeelpcwxnnknkkknknknknkrmhhhhhhhhhhqrhhheeepcwutrshhhhhhhhhhfqhheeejpawugbhhhhhhhhhhhheeeeeejd`uinrmhhhhhhhhhhhlepjeeeejjd`bshhhhhhhhhhhleeeeeejdwtirbhhhhhhhhhhhlecjjeeejpawxicooooleeeeeeeejd`tishhhhhhhhhhhhpejdwxnnnnkneejwapjjd`tinkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkknkkkkknkkkkkkkkkknknnknkkkkknkkirvhhhhhhhhhhhhhhhleejdwxnnkknkknnkknnnnkknnknknkkkkrvhhhhhhhhhhhhhheeeeeeeejpdaaashhhhhoeeeeeejpauinknknkkknkkkkknrfhhhhhhhhhhmmhhleejdauturvhhhhhhhhhhqhhoeeeepd``tshhhhhhhhhhhheeeeeejp`tirghhhhhhhhhhhoejjeeeeejdauxmhhhhhhhhhhheeeeeeepcwxnrfhhhhhhhhhhhepjleeejpcwxnkkncppleeeeeeeejdwtibhhhhhhhhhhhhhjjd`xnkkkkknnit`dpjd`tnnkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknkkkkkkrrvhhhhhhhhhhhhhhhhleejd`tnnkkknnknnkkknnkknnnnnnkkkkrqhhhhhhhhhhhhhoeeeeeeejjpdddc`vhhhhleeeeeejd`tnnnkkkknkknknkknrhhhhhhhhhhhshhoeeejdawwwrhhhhhhhhhhhhhoeeeejpda`rfhhhhhhhhhhhleeeeeejdwtirfhhhhhhhhhhhlejeeeeejpawxrvhhhhhhhhhhoeeeeeeepauxrghhhhhhhhhhhlejjeeeejd`uxinnnntwcpeeeeeeejdwxnrhhhhhhhhhhhhhhjp`unnknkknknxucppcwtnnkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkknkkkknkkkkkkknknkkkkirvhhhhhhhhhhhhhhhhhheejp`uinknkknnknnnkknkkknknknnnknbhhhhhhhhhhhhhhoeeeeeeejpdcccc`mhhhhleeeeeepcwtiknknknnkkknkknnshhhhhhhhhhffhheeeepdaw`gghhhhhhhhhhhhhleeeejjdcwbhhhhhhhhhhhhleeeeeepcwxrghhhhhhhhhhhoeleeeeeepc`xxrhhhhhhhhhhhleeeeeejd`tirfhhhhhhhhhhhlejeeeeepcwtinnkinxwcpjeeeeejpawxnnmhhhhhhhhhhhhhhjcwxnkknkknniu`ddcuxnkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkknknkknkkknrvhhhhhhhhhhhhhhhhhhheeepcuinnnkkntknnnknnkkknnknnkknimhhhhhhhhhhhhhhleeeeeeeejcwwwaushhhoeeeeeejepwxnnnknknknnknkkkrvhhhhhhhhhhqhhleeeepca``bmhhhhhhhhhhhhoeeeeejppdbmhhhhhhhhhhhoeeeeeeejawxrfhhhhhhhhhhhleeeeeeejpauxrghhhhhhhhhhheeeeeeejdwtrghhhhhhhhhhhhejeeeeejdauinnknnixuadjeeeejjd`uinkrhhhhhhhhhhhhhhqd`uinkkkkkkitwac`uinnkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkknnknnrshhhhhdfhhhhhhhhhhhhhoeejc`xnnknkainnnnnkkikkkknkknkurvhhhhhhhhhhhhhheeeeeeejdawuttwbshhhoeejeeejdcuxnkknknknkkkknknrqhhhhhhhhhhhhheeeejpcaawrqhhhhhhhhhhhhleeeeeljjarqhhhhhhhhhhhoeeeeeejpaurghhhhhhhhhhhheeeeeeeepcwxirmhhhhhhhhhhheeeeeeepcuxrmhhhhhhhhhhhleeeeeeepdwxinnnkknitwcdjjjjpd`uxinnnmhhhhhhhhhhhhhhqcwxnnnnknnnxu``wtikkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkknkkkkkkkkkknkkkkkkkkkkknrshhhhhljmhhhhhhhhhhhhhoeejdatinknkanknnnuunkkxxknuini`rhhhhhhhhhhhhhhoeeeeeejed`tiiwwishhhljjjeeejdcxinnnkkkkkiuxukuighhhhhhhhhhhhhoeeeeejcaagghhhhhhhhhhhhoeeeeeejjjwghhhhhhhhhhhheeeeeeejd`trfhhhhhhhhhhhoeeeeeeejpauxnrqhhhhhhhhhhleeeeeejd`uirhhhhhhhhhhhhleeeeeejpawxnkknkknnxuwccdddcautinkkkrqhhhhhhhhhhhhhhpauxnknkkknixuutxnnkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkknknknknrshhhhhletrhhhhhhhhhhhhhheeepcuxnkkxxknnkwutwkntwnnutnnsghhhhhhhhhhhhhhoeeeeeeejd`xinuanshhhedppjejpccxnnnnnnnknna`waubmhhhhhhhhhhhhheeeeejepcabmhhhhhhhhhhhhleeeeeejjdbmhhhhhhhhhhhheeeeeeejcwrbhhhhhhhhhhhheeeeeeeejcwtinghhhhhhhhhhhleeeeeejdwtrshhhhhhhhhhhheeeeeeejcatinnkknknnnitu``a`wuxinkkkknghhhhhhhhhhhhhhqp`tinknkkknnxxinnkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkknknknkkkkkknkkkkkknkkrshhhhhleukrqhhhhhhhhhhhhhleejc`tnnkukkknn`da`kknunknuknrmhhhhhhhhhhhhhhleeeeeejpwxinnntishhheuccjjjpacinknwdddd`ktukukrvhhhhhhhhhhhhleeeeeejec`rqhhhhhhhhhhhoeeeeeeelparqhhhhhhhhhhhleeeeeejpawrmhhhhhhhhhhhheeeeeeejpauiirmhhhhhhhhhhheeeeeeejcwxrvhhhhhhhhhhhoeeeeeejpautinknknkknnnnxtttutxinnkkkkkkfhhhhhhhhhhhhhhhd`tnnnknknnnnnnkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknknrbqhhhhleuknnmhhhhhhhhhhhhhheejpauinkuknkkutnnwnknunkkunkrfhhhhhhhhhhhhhheeeeeejjpwxnnnkunmhhlexcapjjd``inkknnnknknutkunrhhhhhhhhhhhhhleeeeejjjcughhhhhhhhhhhhleeeeeeejpgghhhhhhhhhhhhleeeeeejd`trqhhhhhhhhhhhleeeeeeejc`tinrqhhhhhhhhhhoeeeeeejpauirhhhhhhhhhhhhoeeeeeejp`tninnkknknkknnnnxiiinnnnknnknknqhhhhhhhhhhhhhhjawtnknkkkknknkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkknknknkkkkkkknkkkkibqhhhhoe`knnxghhhhhhhhhhhhhheeepcwxiniuknk`kkiaknn`nnuuknrhhhhhhhhhhhhhhoeeeeeejdduinnknukgqhlan``dppcw`irikknnnnnnuuktnshhhhhhhhhhhhoeeeeeejjdabshhhhhhhhhhhheeeeeeeejdbmhhhhhhhhhhhoeeeeeeejc`bghhhhhhhhhhhheeeeeeejpcuxnighhhhhhhhhhhleeeeeejd`uighhhhhhhhhhhhleeeeeejc`tnkknknkknkknkkknnnnnnnnnknknkkrqhhhhhhhhhhhhhhjautnknkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkknrbqhhhhoedniniusfhhhhhhhhhhhhhleepc`tinnakkkidcuwwnnicdxdtishhhhhhhhhhhhhhleeeeeeejjpankucddcadejppjjddjpdbsqmnkkknnxd`kdrmhhhhhhhhhhhhleeeeeeeec`rfhhhhhhhhhhhlleeeeeejd`rqhhhhhhhhhhhoeeeeeeepaurshhhhhhhhhhhheeeeeeejd`tinrmhhhhhhhhhhheeeeeeejc`trshhhhhhhhhhhheeeeeeepcuinnkknkknknnnkkknnknknknnknkkkknshhhhhhhhhhhhhhod`uxnnkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkknknkknkknkibqhhhhoednnixu`amhhhhhhhhhhhhhoeejd`uinnxxnkknknkkkknknknkrvhhhhhhhhhhhhhheeeeeeejcwxnnkkkkkknkknntwcdc`tibqhhcnkkkkknnnkrqhhhhhhhhhhhheeeeeeejpctbhhhhhhhhhhhheeeeeeeepdgghhhhhhhhhhhheeeeeeejdaurfhhhhhhhhhhhoeeeeeeepawxnnbhhhhhhhhhhhoeeeeeejpauirvhhhhhhhhhhhheeeeeejdatinnikknkkkkknknkkkkkknknnkknknknnmhhhhhhhhhhhhhhlc`tinknkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkirvhhhhhedkniiuwcdshhhhhhhhhhhhhheeepauxinnknkkkkknnkknknknnrqhhhhhhhhhhhhhheeeeeejpauxnnnknknkkknnnxwcdawxrvhhoeikkknknknnbhhhhhhhhhhhhleeeeeeejdabshhhhhhhhhhhoeeeeeeejparmhhhhhhhhhhhheeeeeeejcwxrhhhhhhhhhhhhleeeeeejp`uinrshhhhhhhhhhhleeeeeejd`uirvhhhhhhhhhhhheeeeeejdwtiknnnkkkknnknknkkkkkkkkknnnnkkkknnvhhhhhhhhhhhhhljcwtinkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkknkkirvhhhhoejknnxuwcdp`fhhhhhhhhhhhhhleepcwtinnnnnknnkkkkkkknkknghhhhhhhhhhhhhhoeeeeeejd`tinknkkkkkkkknitwacaurshhhlpnknnnknknimhhhhhhhhhhhheeeeeeeepcwrfhhhhhhhhhhhleeeeeejjdwrfhhhhhhhhhhhleeeeeejpaurghhhhhhhhhhhheeeeeeejcwxinrqhhhhhhhhhhheeeeeeejdwtnrhhhhhhhhhhhhoeeeeeejcwxnknkknkkkknnnkkkkkkkknkknknnnnkknnifhhhhhhhhhhhhhedauinnkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkknkkknknkkkrrvhhhhheliknit`adpdcshhhhhhhhhhhhhoeejdwtinnknknknknknknknnnishhhhhhhhhhhhhhleeeeeejdwtnnkkknnkkknknnxw`a`rbqhhhlwnnknnknnnrvhhhhhhhhhhhheeeeeeejdatbhhhhhhhhhhhoeeeeeeljpatbhhhhhhhhhhhheeeeeeeedatishhhhhhhhhhhoeeeeeejpawiirmhhhhhhhhhhhheeeeeeepcwxnrhhhhhhhhhhhhoeeeeejpawxnknnnknkkkkkkkkkknkkkrsrkknknnknknnbqhhhhhhhhhhhhejd`tinkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkknnrvhhhhheennnixuadpdcabhhhhhhhhhhhhhheejdatinnnnknkknknknnnkknrfhhhhhhhhhhhhhheeeeeeepawinnkknknkknnnnnxtw`brfhhhoexknnninnnnrhhhhhhhhhhhhleeeeeeejcwrshhhhhhhhhhhoeeeeeelpcwbshhhhhhhhhhhheeeeedejdwtrmhhhhhhhhhhhoeeeeeejd`uiirqhhhhhhhhhhhoeeeeeejp`txnrhhhhhhhhhhhhoeeeeejd`tnikknkknnrnkkkknknkkknbhhmnkknnknkknishhhhhhhhhhhhljjcwxnnkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknrmhhhhhllnnnituacpdc`urhhhhhhhhhhhhhhleepcwxnkknnnnkknknkknnnnrhhhhhhhhhhhhhhoeeeeeejpatinkknnkkknkkknnnxtxrvhhhholnknnixxinishhhhhhhhhhhheeeeeeejpaurvhhhhhhhhhhheeeeeeljpaurvhhhhhhhhhhhleeeejrsaawxrvhhhhhhhhhhhleeeeeejc`tnrshhhhhhhhhhhhleeeeedddwtnnrhhhhhhhhhhhhoeeeeejdwxxnnkknnnrghgkkkkknnkkkshhhcnkknnnnknnimhhhhhhhhhhhoejpawinkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknnrshhhhhleunnixwacppc`uxrmhhhhhhhhhhhhhleejd`tinkknknknnnnknknnishhhhhhhhhhhhhhoeeeeeejd`xinkkkknkknnknnnnnrrvhhhhheannnxxtxinrmhhhhhhhhhhhoeeeeeeejc`xrhhhhhhhhhhhheeeeeeljc`trqhhhhhhhhhhheeeeebghhctirvhhhhhhhhhhhleeeeeepauxibqhhhhhhhhhhhheeeeelrsswinkrhhhhhhhhhhhhoeeeeejcwxnnkkknkrbqhhfkkknkkkknshhhenkkkknkkknirqhhhhhhhhhhoeejd`tnnkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkrshhhhhleunnituacpdd`wxnnshhhhhhhhhhhhhheejpauxnnnkkknknnnnkknkimhhhhhhhhhhhhhhleeeeeejcwxnnkknnnkknnknknnirvhhhhhhexnnxuwwuxirfhhhhhhhhhhhleeeeeejjawrshhhhhhhhhhhleeeeeelpawrbhhhhhhhhhhhheeeearqhhl`iivhhhhhhhhhhhleeeeejp`wrrmhhfhhhhhhhhhheeeeegbhhfikkiqhhhhhhhhhhhheeeeejcuxnknkkkirfhhhldkknkkkkimhhhlnnnnkknnnknishhhhhhhhhhoeejpauxnkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkknrshhhhhletnnixwaddpc`wxiknrhhhhhhhhhhhhhheeejcwxnnknknknnnnnnknnrfhhhhhhhhhhhhhheeeeeejpaunnnnnnknkkkknkkkrrvhhhhhhoennxtwaawxibhhhhhhhhhhhheeeeeeejdaurvhhhhhhhhhhheeeeeeejpaurshhhhhhhhhhhoeeejrmhhoeunivhhhhhhhhhhhleeeeejd`trshhmhhhhhhhhhhoeeee`rqhhlcnnnvhhhhhhhhhhhheeeeepawxknnkkirvhhhoe`kkknkkkrvhhhounknnnkknnnnrqhhhhhhhhhoeeejdwxnkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkknrshhhhhoeannixw`cppdauxinkkifhhhhhhhhhhhhhoeejd`txnnnnkknknknknknbhhhhhhhhhhhhhhoeeeeeeedaunnnkknkkkwcxnnirbqhhhhhhhldnitwacawtrghhhhhhhhhhhheeeeeeejcwxrhhhhhhhhhhhheeeeeeejcwtrmhhhhhhhhhhhleeegghhhedinivhhhhhhhhhhhleeeeejcwrbqhhshhhhhhhhhhleeecrvhhoe`kknmhhhhhhhhhhhhoeeejpauinkkknrshhhhepnnkknnnkrfhhhhdniiiinnnknnnshhhhhhhhhleeejpatikkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkknkkkkkkkkkkkkkkkkkkinrshhhhhhejknixu`cpdcawtinknknfhhhhhhhhhhhhhheejpauxnnkknnknknnnknimhhhhhhhhhhhhhhleeeeeejd`tinknnknknkntnrrshhhhhhhhheuitucpdauxrfhhhhhhhhhhhleeeeeejpaurghhhhhhhhhhhoeeeeeelpcwxrvhhhhhhhhhhheeebbqhhleunnnmhhhhhhhhhhhheeeeeparbqhhvmhhhhhhhhhhleepbshhhepnnkkghhhhhhhhhhhhheeeepauxnkkirshhhhlenknnnknnnrhhhhhjixttxinknknnghhhhhhhhheeeeepawxnkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkknkkkkknnnkknrrghhhhhhoeitxxu`ddpdawwuxkkktrshhhhhhhhhhhhhhoeepcwxinkkntxuntinknrfhhhhhhhhhhhhhhleeeeeepcwxnnittnknnnnrrgfhhhhhhhhhoewwuapjjdairhhhhhhhhhhhhleeeeeejd`trmhhhhhhhhhhhleeeeeejdauxrfhhhhhhhhhhheebbqhhoeaxnnkshhhhhhhhhhhhqeeej`rbqhhorvhhhhhhhhhhleprshhhletnknkiqhhhhhhhhhhhhqeejp`tinnirvhhhhleukkniniiinrhhhhhhutuuuxinnnknrhhhhhhhhheeeeejcwxnkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkknnnxkkktnixikirvhhhhhhhopawtu`cppdcwuwuwxnktxshhhhhhhhhhhhhhhjejd`tinnkn`uw`t`nkrghhhhhhhhhhhhhhhleeeeejpcuxikutuwnknirgfhhhhhhhhhhhlj`p`djjpcwrghhhhhhhhhhhheeeeeeejcwxrqhhhhhhhhhhheeeeeeejdwtirhhhhhhhhhhhhvrbqhhoejtnnnirhhhhhhhhhhhhhvmwrrmqhhoerhhhhhhhhhhhfsrshhhleannnnnimhhhhhhhhhhhhhfcppatiirbfhhhhoewnnnixtutxighhhhhhjw`awtnnnnnnrhhhhhhhhleeeeejd`tikkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkknnkkkkininitrbvhhhhhhhhhdxwuwcppdcwtx`cutnnnrshhhhhhhhhhhhhhhqplddpcccwkxtkuntnirfhhhhhhhhhhhhhhhleeeeeejjdtnkwawtirrsfhhhhhhhhhhhhhed`adpjjcwxrmhhhhhhhhhhhoeeeeeejpauighhhhhhhhhhhoeeeeeejpcuxirhhhhhhhhhhhhhvhhhhleaxiknxtvhhhhhhhhhhhhhhvvhhhhheprhhhhhhhhhhhhvfhhhoepxiknnxxxqhhhhhhhhhhhhhqsgrrbsfhhhhhoednnkixww`uxrshhhhhhqaacauinnknighhhhhhhoeeeeeejd`xinkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkknnkkxnnirrgqhhhhhhhhhhmt``cdppc`uxwikntknirfhhhhhhhhhhhhhhhhqscawxnkkkxtktnxrrvhhhhhhhhhhhhhhhhqcpeeejc`xiitrrrbsvhhhhhhhhhhhhhhhoewcjjjjjawxrfhhhhhhhhhhhleeeeeejc`trmhhhhhhhhhhhleeeeeejdatinrhhhhhhhhhhhhhhhhhledwxinxtwshhhhhhhhhhhhhhhhhhhhelirhhhhhhhhhhhhhhhhoejuxinixtuushhhhhhhhhhhhhhhhhhhhhhhhhoecnknitu`aawtrshhhhhhhqddcwxnknnrfhhhhhhhleeeeeejd`tnnkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkknkkxrrgvhhhhhhhhhhhhhfgbuppc`uxiunirrrbsfhhhhhhhhhhhhhhhhhhhfsbrinknxxirrbsqhhhhhhhhhhhhhhhhhhqmsrrrrrrgsgmvqhhhhhhhhhhhhhhhhhhoe`djejejatxbhhhhhhhhhhhheeeeeeejcwtrfhhhhhhhhhhheeeeeeejcwxnnifhhhhhhhhhhhhhhhlejauxiiuw`wqhhhhhhhhhhhhhhhhhhlexkifhhhhhhhhhhhhhhheeauxxixww`wumhhhhhhhhhhhhhhhhhhhhhhhoedkkiixu`cca`trvhhhhhhhhmcd`tnnnrshhhhhhhleeeeeeejd`xnkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkknkkkkniinkkkngqhhhhhhhhhhhhhhhhhhqhpauxnktarvqhhhhhhhhhhhhhhhhhhhhhhhhhhhfskiaurvhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhejejeejjdddgshhhhhhhhhhhoeeeeeejpaurbhhhhhhhhhhhoeeeeeeepcuinknmhhhhhhhhhhhhhhleed`uxitu`awgqhhhhhhhhhhhhhhhhlewnnkmhhhhhhhhhhhhhheep`txxxuwa`wtimhhhhhhhhhhhhhhhhhhhhhlednnkxxu`cccauxrvhhhhhhhhhfgubrrbmhhhhhhhlejjeeeeejdwtnkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkknghhhhhhhhhhhhhhhhhhhhhj`tinkkkrhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhowkkkrhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhejjeeejjcuxrvhhhhhhhhhhhleeeeeejd`tishhhhhhhhhhhleeeeeejd`uxnnknhhhhhhhhhhhhhleejd`uttw`aawxshhhhhhhhhhhhhhheeaxnniiqhhhhhhhhhhhoeeedautttwaawuxinahhhhhhhhhhhhhhhhhhoeeunnnixuwaccawtirqhhhhhhhhhhhhvvfhhhhhhhhlepdjeeeeepcuxnnkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkrhhhhhhhhhhhhhhhhhhhhhewxnkkkkkhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhodnkkkhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhoejjeeejpauxnhhhhhhhhhhhheeeeeeejcwxivhhhhhhhhhhheeeeeeejd`tnnknkrhhhhhhhhhhleeeejdawuw`aawuxiwhhhhhhhhhhhhoeecwttxtuwhhhhhhhhhhleeejpawuw`aa`wtnnnn`ohhhhhhhhhhhhhholejxnnnxtu`cddawuxnrhhhhlllohhhhhhhhhhhhhhlee`wcjeeeejdauinkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkteeeeeeeeeeeeeeeeeeeeewxnnkkknkeeeeeeeeeeeeeeeeeeeeeeeeeeeeeepnnnkkeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeejd`tinneeeeeeeeeeeeeeeeeepauxnkdeeeeeeeeeeeeeeeeepcuxnnknknnoohhhooleeeeeeepcaaaaa`uxnnnxoohhhhhholeeejda`www`adohhhhhhoeeeeeepdaa`acawtxnnnnitplohhhhhhhhoolee`tttttu``ccdc`txinihhhel``dllohhhhhhhholeeaixwdjeeeejcwxikkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkknnnixuwadpeeeeejdwtinnnkkkkkknknnniixwapeeeeeeeeeeeeepc`txinnnnknknnkniiuwcpleeeeeeeeeeelpawxinnnnnnnnixxxxuuw`adpjjeeeeeeepcwtnknknnnniuadleeeeeeejp`tinkkknknixwdjeeeeeeejd`uinnkkknkn`peeeeeeeeeeeejpddccawtiiknniclllleeeeeeeejpccccccccpllleeeeeeeeejpdccca`uiiknknnxwajeelllleeeeepc`wwww`acddda`utnnnnglejxnxwdjeeelllleeed`knit`djeejjdauxnnkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkknknnixuwadjjeeeeejdawtxinnnkknkknnnixtu`cpleeeeeeeeeeeejpc`uuxiinnnknnnixuwapjeeeeeeeeeeeeejc`utxiniixxxxtuuw`acdppjeeeeeeeejpatxikknkkkniuapjeeeeeeejdwtnnkkkkknit`djeeeeeeejd`tnnknnknknniuapeeeeeeeeejjjdcawtinnknnixwcleeeeeeeeeejjpppdcawuucpjeeeeeeeeejjpdc`uxinkkkknitwcpjeeeeeeeeejppdcccddppdc`uxinkkkiuuxnit`djeeljjdc`iinnnnxwcpjeejpawxnnkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkknitw`cpjjeeeeeejjda`wtxnnkkknknixtuw`cpjeeeeeeeeeeeeeejpca`wutinnknnitw`cdjjeeeeeeeeeeeeejpcawwuuuuuwww``acddpjjjeeeeeeeeejd`tinnknkknnxucpeeeeeeejpcwinnkkknkiiuadjeeeeeejjawxnnkkknknknitadjeeeeeeeeejpdcwtinnknkkniu`djeeeeeeeeeeljjpdawttxuadjeeeeeeeejjpc`utinnknkkknitwcpjeeeeeeeeeejjjjjpjpdc`tixnknnnknkkkxtadjjeejpd`wuxxxxxw`djjjjpcwtinkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkknkixuacdjjjejeejejjddaawtinnkkknnxtw`acdpjejeeeeeeeejejjjjpdaa`utinnnitwacdpjjeeeeeeeeeejejjjddcaa`a`aaacccddppjjejejeeeeejjpcwxnknkknnknxwcpjeeeejejd`tinkkkkknnxuapjjeeeejjdauinknkknkkknixwcpeeeeeeeejjpa`txnknknknnnxwadjleeeeeeeejjpdawtiiitwcpeeeeeeeejpcauxinknknknknnxtwcdjjeeeeeeeeejjjjjpcawuxikikknknknnnitapjjjjjppcawuuuuwacpjjjda`txnnknkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkknntw`cdpppjjpjpjppddca`uxnnkkknixu`acddpppjppjpppjpjjjpppddcaawtxnnnxu`acdpppppppppjppjjpjppddccaccacccccddddppppppjppppjpdc`txnkkknkknnxwacpppppppdcwxinkkkknknxuacpppppppdawxinknnkknkknnxuacpjejejjjpcautinknkkknknnxxwadpjeeeejejjpd`wxinnniu`cpjeeeejjpc`utnnknkkkkkknnnxtwacppejeejejeejjpdcawuinnkkknknknkknxu`dppppddddcca```ccdpppcawxxnkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkknnxu`aaaccacccacacaaa`wtinkknkknitw`aaaacaacccccacccaccacaca``wtinnnitw`aaaaacacacaccccccacaaaa````a`aaaaaaaacccacaccdcacaawuxnnkknkknknxuwaaccccaa`wuinknkkkknnitwaaccccacawtinknknknnkknnnxu`cdpppddcawuxinnkkkkkkknnnitw`ddppjjppdda`uxikkknnxu`ddppppdcawuxnnknknnkknkknnnitu`acdppjjjjpppdc`wuxinnknkknkkkkknnit`cccaaaaaccccccacdcccawuxinkkkkkknkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkknixtuuuuuwuuuwuuuuuuttxixkkkknnixttuuuuuwuuuuwuwuuuwuwuwuuuuttxnnnnxattuuuwuuuuudauuutuuwu`uuuuuuwuuuac`cuwuawuuuwuwawwuutxxnnnkkkkknnnnxcwuuuuuuuttinnkkkkkkknnactuuuuu`ctxxii`iwikknkkknnixuw`aaa``wutxinkkkkkkkutkkknixuwaaccccaawutxnw`ikkkixu`acdccawuxinnnkkkkknknki`kknnxxuwaadccccca``wuxinnnkkkkkkknnknkkitu``wuuuuww```aaaaaa`wutxiknkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkknnixxxxxxxxiiiiiiixinnwnkkkkknnnniiiiiixixixxixixiixxxxxxxxiinnknnntiiixxxixxxxpxxixxiii`txxxxiuwixiucupixiiwixixixwiixxiinkkkkkkkkkknnniuxxiiiiuiinnkkkkkknkknntiixiiuxiatnnkdndxkknknkknnnxxtuuuuxxxinnnkknkkkkkxknkkknuxuuwwwwuuxxinnknxkkknnixuuwwuutxnnkkkkkknknkkkkxnknknnittuwawwwuuutxinnnkkkkkkkkkkkkkknnixuttxiixxttuuwwwuuuttxinnkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkknnknnnnnkninnnknnnnnkwkknknxinkntnxxinnxxnxtknnnnttnnnxxxtiknkkixnxnnnnnnnnnnuunnnnknnnwnnnnnnunnnnt`icnnnnunnknknitnnnknkknkkkiinxxknnnxxtnnniwxxxnkxixninnkkkxnnknkxnnnnknkck`nknkkknkknknnniiiiinnnkknkkknkkkkinxnkniwtuwtxututitnnkkkxnkkkknnixiutuxixknkkixnkkknxxnxkknnxxnniix`xxxxiinnnnkkkkkkkkkkkknkkkkkniininnnnnniixxxxxxiinnknkknkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkknkknknkknkknknkkkkkkkkiikkkkxxxtkkxwuxttknu`xx`kkxuxxwnkiwtxtiknxtxuwkkkkknkkknunkkkknkkiiknnnnntknkknukukkkkktkkkkkntkkkkkkkkkkkiuwxxwkkk`xxukknuxxnkkxwxwxtiknkxkkkkkiwinkkkk`kukknkkkkkkkknknnnnnknknkkkkkkkknkkutxtnknutttnntwtwxxtkkkkikkkkkknnnnx`xwxxxkkutxuxnkitxuwkkxuxiwnnnnxxnnnnnnnkkkkkkkkkkkkkkknkknknnnnknkkknknnnnnnnnnnnknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkxkkkkktwutkkktkkktkktkkknxnuixxtukkikkkxkkxkkktnnknkkknkkkkknkknkkxkkkkkkkxkkkkkkkknknkktnkkkkkntkkkkkkkkkkktkkknxnkxkkxkkkxkkkkkkukxkkxkkkxkkkkkkkktikkkknkkkkknknkkkkknkkkkknkknknknknkkkkkikkkxkkxkknnnk`ktkkxkknkxkknkwuwwwikwkxkkiknnkkkxkktkkktkkuiixtukkkkxkkkkkkkkkkkkkkkknkknkkkknkkkknknkkkkknknkkknknknkkknknkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkknkkkkkkkkkxkkkkxnkkxkkktkkkxnktkkknikwiixiinkxkkkxkkxkkkikkkkknkkkkkkkkkkkknikkknknkxknkkknkknkknknukkkkkkwkkkkkkkknkktkkknikkxkkxkkkxknkkkkwkikkxkkkxkkkkkikknxkkkkkkkknkkknknkkkkkkkkkkkkkkkkkkkkkkkkxkknxkkxknkkknwkxkkxnkknxkkkkkkkkknkwkikkikxkkkkxkkxkkkxknuxiixnkkkkxkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkknknkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkknkknikkkxkknukkkwnknxkkutknukkttkkknkkxnnkxkktnkiwkknkkkkkkkkkkkkkkkknxkkknkntkkkkkknkkkknkktkkkkkknnkkkkiukkkkttkntkkkxkkikkktkkknkkukxkkxkkkxkkkkkttxxkkkknknkkknkkkkknknkkkkkkknwiknkknkkkkkkxkkkxkkinknnkkwkikkinkkkxnknkkkkkkkkukikkikktnknxkktnkiwkktxkkknknktkkkkkkknknkkkkkkkkkkkkkknknkkkkkkkknkknkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkktkkknuuixtkkituxkkkinutnkkkiuwiknxuikxukkktuxnwkkknknknkkkknkkkkkkukknkkktnkkkkkknkkkkkkntkkkkkkukkkkiukkkkinutnkkuuknuukkkuwuikuukxnkukxuuwuikkkkiknkkknkkkkkknkknkkkkkkkkkkknunkknkkkkkknxunkuuikkxwuxktuinxkxinwuuutkkkkkkkktuinxkxnkkuuxkkkkuuxnukknuuiknkkukkkkkkkkkkkkkkkkkkkknkkknkkkkknknkkkkkkkkkkkkkkkkkknknkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkknkkkkknnkkkkkkkkkkikkkkkkikkkkknkkkknkkkkkknkkkkkkkknkkkkkkkkkkkkknkkkkkniknknkkxkkkkkkkknknkkknnkkkkkikkkkkkkkkkxkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkknknkkknkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkknkkknkkkkkkkkkkkkkkknknkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkxnkkkkkkkkkkknkkkkkkkkkkkkkknknkknkkkkknkkkkkkkknknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkuwtkkkkxwuknkkknkkkkknkkkkkkkkkkkkkkknkkknkknkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkxwunkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkknknkknkkkkkkkknkkkkkkkknkkkkkkkkkkkknknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkknkkkkkkkkkkkkkkkknkkknkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknknkkkkkkkkkknknkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkknkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkknknkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkknkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkknkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkknkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkknknknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkknkknkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknkkkkkkkkkkkkknkkknknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkknknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkknkknkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkknkkkknkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkknkknkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkknkkkkknkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkknnkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkknkkkknkkkkkkkkkkkkkkknknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkknkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkknknknktixikkkxkkkkkkinkkkkkkkkkkkkkkkkkkknxkkkkkkkkkkkkkkkkkkkkknxnkkkkkkikkkkkixnxkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkktikkkkkkkkkkkkkkkkkkkkktxkkkkknkkkkkkkkkkkkkkkkkkkkkkkkinkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkknkkkkkkkkkkkkkkkkkkxnkkkxixtkkkknkkkkkkikkkkkkkkkkkkkkkkkkkknkkkkkkknkkkkkkkkkkkkkkknkkkkkikkukkkntnukkkkkkkkkkkkkkkkkkkkkkknkkkknkkkknkkkkkknkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkknkkkkkkkikkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkikkkkxnixkkkkikkkkkkiknkkkkkkkkkkkknnnkkknknkkkkninnkkknnnknkkkkknkkkkknkkkkkknxktkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkinikkkninnnkkininnnkkkknkkkkkkkkkkkiniknnkkkknikkkkknnknkkkknkkkkkkikkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkknnkkknnnnnkkkkknkkkkkkikkkkkkkkkkknxnninkkninnnkkninnkkkinninikkkknkkkkkninkkkkkikikkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkxnnikkninnnkknxnxninkkknkkkkkkkkkkknxnxnnnkkxnnxnkkinnxnkkinniikkkknkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkikkkkkkikkkkkkkkkkknnnnnxkknkkknkkknkkkkknnknknkkkknkkkkkkkkikkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknkkknkkkkkkxknkknkkknkkkkkxxxxxkkxknkknknkkkknknkkkknkkinnnikkkknkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkknkkkkkkkikkkkkkkkkkinnnnnkkkkkknkkknkkkkknnknknkkkknkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkknkkknkkkkkkiknkknkkknkkkkkkkkkkkkiknkknknkkkknknkkkknkkinnnnkkkknkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkknkkkkkknkkkkkiikkkkikkkkkknkkknkkknkkkkknkkkkkkkkknkkkknninkkkkkkkkkkkkkkkkkkkkkkkkkkkkikkkkkkkkkkkknkknkkknkkkkkkiknkknkkknkkkkkkkkkkkkiknkknknnkknkkknkknnkkxkkkkkkkknkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkkkkkkkkkknkkkkkkknkkkknnkkkkkiinkkknnknnnkkkinnkkinkikknkninnikkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkknikkkkkkkkkkkiikkiikkkninkkiiknnkiknninikkkkkkkkkinknkkikkkiinkkkkinnnnkkniikkkkknkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkknkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk",
+"kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk"
 };
 * CL::		A Common Lisp compatibility package for Emacs-Lisp.
 * Custom::	Customization Library for Emacs
 * Ediff::	A Visual Interface to Unix Diff and Patch Utilities.
+* EFS::		Transparent remote file access via FTP
 * External-Widget::
 		Use XEmacs as a text widget inside of another program.
 * Forms::	A package for editing databases by filling in forms.
 * Gnus::	A netnews and mail reader for XEmacs.
+* HM--HTML-Mode::  HTML Editing Mode.
 * Hyperbole::	A programmable information management and hypertext system.
 * ILISP::	Multi-dialect inferior LISP interface.
 * Ispell::	Interactive spelling corrector.

lib-src/ChangeLog

+Sun Mar 23 15:57:19 1997  Steven L Baur  <steve@altair.xemacs.org>
+
+	* update-elc.sh (make_special_commands): Use target of x20 for efs.
+
 Wed Mar 19 10:38:04 1997  Steven L Baur  <steve@altair.xemacs.org>
 
 	* Makefile.in.in (SCRIPTS): Link gzip-el.sh in --srcdir

lib-src/emacsserver.c

 #if ! defined (HAVE_SYSVIPC)
 /* BSD code is very different from SYSV IPC code */
 
+#include "../src/sysproc.h" /* Needed for select */
+#ifndef SOCK_STREAM
+/* this is normally included by src/sysproc.h.  might be safe to omit
+ * it entirely.  lousy ultrix's sys/socket.h chokes if it's included
+ * twice, so we can't include unconditionally.  */
+#include <sys/socket.h>
+#endif
 #include <sys/types.h>
 #include <sys/file.h>
 #include <sys/signal.h>
 #include <sys/un.h>
 #include <stdio.h>
 #include <errno.h>
-#include "../src/sysproc.h" /* Needed for select */
-#ifndef SOCK_STREAM
-/* this is normally included by src/sysproc.h.  might be safe to omit
- * it entirely.  lousy ultrix's sys/socket.h chokes if it's included
- * twice, so we can't include unconditionally.  */
-#include <sys/socket.h>
-#endif
 
 void
 main ()

lib-src/update-elc.sh

 #make_special vm
 #make_special ediff elc
 #make_special viper elc
-make_special efs
+make_special efs x20
 make_special gnus  some
 make_special w3 xemacs-w3
 make_special hyperbole elc
+Fri Jul 19 12:01:51 1996  Christoph Wedler  <wedler@fmi.uni-passau.de>
+
+	* packages/info.el (Info-elisp-ref): Look first in lispref, then
+	elisp.
+
+	* packages/func-menu.el (fume-function-name-regexp-bibtex): `,'
+	isn't allowed.
+
+	* packages/etags.el (list-tags): Interactive argument should be an
+	existing file name.
+
+Wed Mar 26 22:33:40 1997  Steven L Baur  <steve@altair.xemacs.org>
+
+	* Remove ns lisp directory.
+	* Remove vms lisp directory.
+
+Tue Mar 25 12:22:57 1997  Steven L Baur  <steve@altair.xemacs.org>
+
+	* prim/files.el (file-remote-p): Update doc string.
+
+	* packages/terminal.el (te-stty-string): Fix definition for Linux.
+
+Mon Mar 24 23:43:53 1997  Steven L Baur  <steve@altair.xemacs.org>
+
+	* prim/files.el (file-remote-p): Correct documentation and allow
+	for `allow-remote-paths' to control loading of efs.
+
+Sun Mar 23 16:58:08 1997  Tomasz J. Cholewo  <t.cholewo@ieee.org>
+
+	* packages/etags.el (with-caps-disable-folding): New macro.
+	(find-tag-internal): Use it.
+	(tags-search): Use it.
+	(tags-query-replace): Use it.  Case bug corrected.
+
+Mon Mar 24 00:47:38 1997  Steven L Baur  <steve@altair.xemacs.org>
+
+	* x11/x-menubar.el (popup-mode-menu): Change guard when stripping
+	keywords to be more robust.
+
+Sun Mar 23 00:26:53 1997  Steven L Baur  <steve@altair.xemacs.org>
+
+	* prim/startup.el (splash-hack-version-string): Correct for case
+	of hosts with '-' in the names.
+
+Sat Mar 22 14:25:47 1997  Tomasz J. Cholewo  <t.cholewo@ieee.org>
+
+	* modes/sendmail.el (user-mail-address): Require cus-edit.
+	Fix when scope.
+
+Sat Mar 22 14:25:47 1997  Tomasz J. Cholewo  <t.cholewo@ieee.org>
+
+	* calendar/diary-lib.el (diary-countdown): New function.
+	(fancy-diary-display): Use modeline-buffer-identification.
+
+	* calendar/appt.el (appt-diary-entries): Do not display diary.
+	(appt-check): Display diary buffer at midnight.  
+	
 Fri Mar 21 19:16:46 1997  Steven L Baur  <steve@altair.xemacs.org>
 
 	* mule/mule-coding.el (enable-multibyte-characters): MULE
-	compatabile variable.
+	compatible variable.
 
 Thu Mar 20 13:28:17 1997  Steven L Baur  <steve@altair.xemacs.org>
 
 			loads a file named $TERM.el from this directory, if
 			that file exists.
 
-	vms		VMS-specific code.
+	vms		VMS-specific code. (Not functional)
 
 	x11		X Window System-specific code.
 
 
 Some packages are fairly large; those have been given their own	directories:
 
+	auctex		A package for editing TeX documents.
+
 	bytecomp	The XEmacs-lisp compiler.
 
 	calendar	A calendar and appointment manager.
 
+	cl		Common Lisp compatibility code.
+
 	comint		General code for interacting with inferior processes,
 			like shell buffers and lisp interpreters.
 
-	dired		The directory editor.
+	custom		User environment customization code.
 
 	edebug		A source-level debugger for Elisp.
 
 	ediff		A comprehensive visual interface to diff and patch.
 
+	efs		The directory editor, remote FTP frontend.
+
+	egg		MULE Input Method.
+
 	electric	The "electric" commands; these implement temporary
 			windows for help, list-buffers, etc.
 
 	eterm		A merge of the comint shell mode with an
 			ANSI-compatible terminal-emulator.
 
-	gnus		An NNTP-based newsreader; version 3.14.
+	gnus		A network news and mail reader.
 
 	hm--html-menus	Menu interface to html-mode.
 
 	ilisp		A comint-based package for interacting with inferior
 			lisp processes.
 
+	iso		ISO Latin language support.
+
+	its		MULE Input Method.
+
+	locale		IE18N stuff.
+
+	mailcrypt	Package for dealing with PGP encrypted messages.
+
+	mel		MIME encoding library (part of the Tools for MIME).
+
 	mh-e		An interface to the MH-E mail handling system.
 
+	mu		Message Utilities library (part of the Tools for
+			MIME).
+
+	mule		Multi-lingual extensions for XEmacs.
+
+	ns		NeXTStep support.
+
 	oobr		An Object-Oriented class browser.